KEGG   Ruegeria pomeroyi: SPO0914Help
Entry
SPO0914           CDS       T00215                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00240  Pyrimidine metabolism
sil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPO0914 (tdk)
Enzymes [BR:sil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPO0914 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: AAV94219
UniProt: Q5LUY8
LinkDB All DBs
Position
complement(968103..968699)
Genome map
AA seq 198 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQASHNYRERGMQTYLMTAAIDGRAGTGRIASRIGIGAEAD
IFTPRDDVFAMIRDRLGAGPVACVFVDEAQFLSPEQVWQLARVVDDLDVPVLAYGLRVDF
QGKLFPGSATLLALADEMREVRTICKCGRKATMVIRQDASGRAITEGAQVQIGGNETYVS
LCRKHWREATGDPGAKGH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctacttcaactactccaccatgaatgccggcaaatcgaccgtcttgctg
caggcctcgcacaattaccgcgaacgcggcatgcagacctatctgatgacggcggcaatt
gacgggcgcgccgggaccgggcgtatcgccagccggatcgggatcggcgccgaggcggat
atctttacgccccgggacgatgtctttgcgatgatccgcgaccggctcggcgccgggccg
gtggcctgcgtctttgtcgacgaggcgcaattcctcagccccgaacaggtctggcaactg
gcccgggtggtcgatgatctggatgtgccggtgctggcctatgggctacgggtcgatttc
cagggcaagctgtttcccggctcggcgacgctgctggcgctggccgacgagatgcgcgag
gtgcgcacgatctgcaaatgcggccgcaaggcaacaatggtgatccgtcaggatgcctcg
ggccgggcgatcaccgaaggcgcgcaggtccagatcggcggcaacgaaacctatgtctcg
ctctgccgcaagcattggcgcgaggcgacgggcgatcccggagccaagggccactga

DBGET integrated database retrieval system