KEGG   Ruegeria pomeroyi: SPO3676Help
Entry
SPO3676           CDS       T00215                                 

Gene name
argE-2
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00220  Arginine biosynthesis
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01130  Biosynthesis of antibiotics
sil01210  2-Oxocarboxylic acid metabolism
sil01230  Biosynthesis of amino acids
Module
sil_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SPO3676 (argE-2)
Enzymes [BR:sil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     SPO3676 (argE-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AAV96898
UniProt: Q5LM87
LinkDB All DBs
Position
complement(3885153..3886298)
Genome map
AA seq 381 aa AA seqDB search
MSLSLEVLERLVAFETVSDRPNLDMIAYVEDFLRTRGFRVHRIADPEEAKAGLFAEIGPS
VDGGLLLSAHSDVVPVEGQSWCVPPFKLTRQGDKLYGRGTTDMKGFLAEMLALADVVHRR
DLHAPLKLLISYDEEIGCVGISRMKDRLRPLLGRPELAIVGEPTEMQVAISHKGKRSYRA
DFRGEAGHSALAPRFVNALHLAVDFVTKLRQMQDEFRQDGNFNGDYDVPYTTLHVGQLHG
GEALNLVPDKATLLFEFRHLAEDDPEVIEARIQQAADAVKGNYADVAHISLDALAGYPGL
SVAVSEPLVSRVRSWCDGNISHVAFGTEAGVLSELGIQTVVCGPGSMAEQGHKPDEFISE
HQLAACSNMLRKGAEEMLYCA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctctcgctagaagtattggagcgtttggtcgcctttgaaacggtcagtgaccgg
ccaaacctcgacatgatcgcctacgtcgaagactttctgcgcacccgaggattcagggtg
catcgtatcgcagaccctgaagaggcaaaggcaggcctttttgctgagatcgggccttcg
gttgacggtggccttctgttgtctgcgcattccgacgtcgtccctgtcgaaggacagagt
tggtgcgtgccacccttcaaactgacccggcagggcgacaagctgtacgggcgcggcacg
acggatatgaaaggcttcttggcggaaatgctggctttggccgatgtggttcatcgccgt
gatttgcacgcgcccctgaagcttctgatttcttacgacgaagaaatcggctgtgtcggg
atttcacgtatgaaagatcgactgcggccactgttggggcgcccggaactggccatagtg
ggcgagccaacagagatgcaggtcgcgatcagtcacaagggcaaacgctcctatcgtgcc
gactttcggggagaggccggccattccgcgctggccccccggtttgtcaacgcgcttcat
cttgcagtcgatttcgttaccaagctgcgtcagatgcaagacgaattccgacaagatgga
aatttcaacggcgactatgacgtcccctacacgacgctgcatgttggccagctccacggc
ggcgaggcactaaatctcgtgcccgacaaagccacgctattgttcgagttcagacatctt
gcagaagatgatcccgaggtgattgaggcccgcattcagcaggcggcagacgcggtcaaa
ggcaactatgctgatgtggcgcacatctcgctcgacgctctggcgggatatcccgggctt
tcggtagcggtctccgaacctttggtatcgcgcgtccggtcctggtgcgatggaaacata
agccacgttgccttcggaacggaggcgggcgttctttcagagcttggcatccagacagtc
gtttgcgggccgggctctatggcggaacaaggccacaaacctgatgagttcatttcagag
caccaactggctgcttgttccaacatgttgagaaaaggtgctgaggagatgctgtattgc
gcttaa

DBGET integrated database retrieval system