KEGG   Simplicispira suum: C6571_01065Help
Entry
C6571_01065       CDS       T05361                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
simp  Simplicispira suum
Pathway
simp00061  Fatty acid biosynthesis
simp00780  Biotin metabolism
simp01100  Metabolic pathways
simp01212  Fatty acid metabolism
Module
simp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C6571_01065 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C6571_01065 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:simp01004]
    C6571_01065 (fabZ)
Enzymes [BR:simp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C6571_01065 (fabZ)
Lipid biosynthesis proteins [BR:simp01004]
 Fatty acid synthase
  Component type
   C6571_01065 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AVO40066
UniProt: A0A2S0MW00
LinkDB All DBs
Position
complement(218179..218619)
Genome map
AA seq 146 aa AA seqDB search
MMDIHAILKQLPHRYPFLLVDRVLELERNTRIKAVKNVTFNEPYFMGHFPGHPVMPGVLI
LEALAQAAGLLAFDAMGQVPDENNIYYFVGIDGARFKRPVEPGDQLMLDITIDRVRGGIW
KFKGIARVGDEVACEAQLMCTMRAVG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggatattcacgcaattctcaaacagctcccccaccgctacccctttctgctggtg
gatcgggtgcttgaactcgaacgcaacacgcgcatcaaggcggtcaagaacgtcactttc
aacgagccctatttcatggggcatttccccggccaccccgtcatgccaggagtgctcatt
cttgaagccctggcccaggccgcaggcctgctggcgtttgacgccatgggtcaggtgccc
gatgaaaacaatatttactactttgtcggcatcgatggcgcacgcttcaagcgccccgtc
gaaccgggggaccaactgatgctggacatcaccatcgaccgtgtacgtggcggcatctgg
aagttcaaaggcatcgcgcgcgtgggtgacgaagtggcctgtgaagcccaactcatgtgc
accatgcgcgccgtaggctga

DBGET integrated database retrieval system