KEGG   Simplicispira suum: C6571_05415Help
Entry
C6571_05415       CDS       T05361                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
simp  Simplicispira suum
Pathway
simp00564  Glycerophospholipid metabolism
simp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C6571_05415
Enzymes [BR:simp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C6571_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Thi4 GIDA HI0933_like Lycopene_cycl NAD_binding_8 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AVO40800
UniProt: A0A2S0MY35
LinkDB All DBs
Position
complement(1145224..1146816)
Genome map
AA seq 530 aa AA seqDB search
MTLSTTPSPTLRADLLERLASSPSYDLVIVGGGATGLGVALDAAARGFRVALVEAFDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLPFVMPSYHCWETPF
YGIGLKMYDALAGKAGLGATEFLGRGRTLECLPSVRQEGLKGSVKYWDGQFDDARLALAL
ARTAARAGAIVLNYMEATSLIHENGRVAGVVCRDTESGQSMTLRSRCVVNATGVWVDALR
EQDAQATGRAVSALVAPSQGVHLVVDREFLASDHALMVPKTADGRVLFAVPWLGKVILGT
TDTPRHDLAREPTPFPDEVAFILSESARYLRRAPLPADVRSVWVGLRPLVKPQDENGDNT
KSLSREHTVLASRSGLVTVTGGKWTTYRAMAEDVLQKCVESGLLARRQGGATNDLPLVGA
PAGRVVHRMCDAPGWHSYGSDAAFVRQLPGVAAELDMGLTEAMVRFAVRNEYARTVEDVL
ARRWRALFLDARRAQGMAARVAEIVAQETGRDPQQVAFEQLAQQYATLPA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtccactacaccgtcacccacccttcgagccgatctgctggagcgtctggcc
agcagtccatcctatgacctcgtgattgttggcggtggggccacagggctcggcgtggcg
ctggacgccgctgcgcgtggttttcgcgtagcactggtggaagcctttgattttgcaaaa
ggcacttcctcgcgggccaccaaactggttcacgggggggtgcgctatctggcgcagggc
aatattgctttggtgagagaagcgttgcacgagcggacgacgctgctgcacaacgcgccg
cacctggcgcagcccctgccgttcgtgatgccgtcctaccattgctgggagacgccgttc
tatggcattggcctgaagatgtatgacgcgctggccggcaaggccggcctgggcgccacc
gagtttcttgggcgagggcggacgcttgagtgcttgccctccgtgcgccaggaagggctc
aagggaagtgtcaaatactgggacggtcagtttgacgatgcacgcctggccttggcgctt
gcccgcacggcggcgcgcgcaggcgccatcgttcttaactatatggaggccacaagcctc
attcatgaaaatggaagagtcgcaggcgtcgtgtgtcgcgataccgagtccggccagtcc
atgaccttgcgttcgcgttgcgtggtgaatgccacgggggtctgggtcgacgccttgcgc
gagcaggatgcgcaggctacgggccgggccgtatcggcgttggtcgctcccagccaagga
gtccatctggttgtcgatcgcgagtttctcgcatccgaccacgccttgatggttcccaag
acggccgatggacgcgtgctgtttgccgtaccttggctgggcaaagttatcttgggaacg
acggataccccgcgtcatgacctggcgcgcgagcccacgcctttcccagacgaggtggcg
ttcattctgagcgagtcggcacgctatttgcggcgcgcgccgcttcccgcagacgtgcgc
agtgtctgggtgggtctgcgcccattggttaaaccacaggacgaaaatggagacaacacc
aaaagtctgagccgcgagcacaccgtgttggcgagccgcagcggtttagtcacagttacc
ggcggaaaatggacgacttaccgcgcgatggccgaagacgtgttgcaaaaatgcgtcgaa
tccggcctcctcgcccgacggcaaggcggtgcaacgaacgatctgccgctggtgggtgct
ccggcaggacgggtggttcatcgcatgtgcgatgctccaggctggcacagctacggaagt
gatgcggcgttcgtgcgacaactccccggcgtcgcagcagagttggatatgggcctgacg
gaggccatggtacgcttcgccgtacgaaacgagtacgcgcgcaccgtggaagacgtcttg
gcgcgccgctggcgagcgctgttcctggacgcacgccgggcgcaaggcatggctgcacgc
gtcgccgaaatagtggcacaggaaaccgggcgcgatccacagcaggtggccttcgaacag
cttgcacagcagtacgccacactgccagcataa

DBGET integrated database retrieval system