KEGG   Simplicispira suum: C6571_07290Help
Entry
C6571_07290       CDS       T05361                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
simp  Simplicispira suum
Pathway
simp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C6571_07290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:simp02000]
    C6571_07290
Enzymes [BR:simp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C6571_07290
Transporters [BR:simp02000]
 Other Transporters
  Pores ion channels [TC:1]
   C6571_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_C_2 GST_C_3 GST_N_2 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: AVO41117
UniProt: A0A2S0MZ93
LinkDB All DBs
Position
1549391..1549999
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSMSPHIVLHEAGLAHEAIAAPTKTHKLADGTDYYTINPLGYVPFLVLDDG
RTLREGPAIVQYLADQAPDKKLAPPAGGFERYQLQEWLTFIGTELHKSFGPFFGGPANDE
YKASVKERLMSRLAFVDQQLAGKDYLMGAQFTVADAYLFTVSGWAKPVGFDLSHLKNLMA
YRDRVGARPAVIATMKAEGLIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactactcccccggtgcctgctcgatgtcgccccatatcgtgctgcacgag
gccggcctggcgcacgaggccattgccgcgcccaccaagacgcacaagctggccgacggc
accgactactacaccatcaacccactcggctacgtgccctttctggtgctggacgatggc
cgcaccctgcgcgaaggcccggccatcgtgcagtacctggccgaccaggcacccgacaaa
aagctggcgccccccgccggcggctttgagcgctaccaactgcaggaatggctgaccttc
atcggcaccgagctgcacaaaagctttggccccttcttcggcgggcccgcgaacgacgaa
tacaaggcgtccgtcaaagagcgtttgatgtcgcgcctggctttcgtcgaccagcagctc
gccggcaaggactacttgatgggcgcgcagttcaccgtggccgacgcctacctgttcacc
gtgagcggctgggccaagccggtcgggttcgatctgtcgcacctgaagaacctgatggcc
taccgcgaccgcgtgggcgcgcggcccgccgtaatcgccacgatgaaggccgaaggtctg
atcaagtaa

DBGET integrated database retrieval system