KEGG   Simplicispira suum: C6571_07935Help
Entry
C6571_07935       CDS       T05361                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
simp  Simplicispira suum
Pathway
simp00970  Aminoacyl-tRNA biosynthesis
simp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:simp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C6571_07935 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:simp03029]
    C6571_07935 (gatB)
Enzymes [BR:simp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C6571_07935 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C6571_07935 (gatB)
Mitochondrial biogenesis [BR:simp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C6571_07935 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AVO41228
UniProt: A0A2S0MZA1
LinkDB All DBs
Position
1695608..1697056
Genome map
AA seq 482 aa AA seqDB search
MTAPLIHGYEVVIGFETHAQLATRSKIFSRASTAFGAEPNTQACAVDLALPGTLPVMNRA
AVECAIKLGLALGSHIAPESIFARKNYFYPDLPKGYQISQFEIPVVQGGEVSFLLGETLQ
TVRLVRAHLEEDAGKSLHEDFTGQSGIDLNRAGTPLLEIVTEPDMRSSAEAVAYARELHK
IVTWIGICDGNMQEGSFRCDANVSVRKPGAALGTRREIKNLNSFKSMQQAMDYEIRWQIE
EIEDGRAIEQATVLFNPDTGETRAMRSKEDAADYRYFPDPDLPPLVIAEQWIEDIRAHMG
ELPRAMAARFVADYGVPEYDAAILTQSKAMAAYFERAAQASSQPKLASNWIMGELARRLN
AEERSIEQAPVGAEQLAQLLQRINDATVSNNAARQVFEALWSGAGSDVDALIDFLGLRQM
NDTGALEALVDQVIAANADNVAQYRAGKDKAFNALVGQVMKASKGKANPQQATDLLRKRL
VR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccctgattcacggctacgaggtcgtcatcggcttcgagacccacgcccaa
ctggccacacgcagcaagattttcagccgtgcttccaccgcctttggcgccgagcccaac
acgcaggcttgcgcggtcgatctggccctgcctggcacgctgccggtcatgaaccgcgcg
gccgtggaatgtgctatcaaattaggacttgcacttggctcccacattgcgccagagagc
atttttgcccgaaaaaactacttttacccggatctgcccaagggctaccagatcagccag
ttcgagattccggtggtgcagggcggagaggtgtccttcctgctcggcgagaccctgcaa
actgtgcgcctggtgcgcgcccacctggaagaagacgccggcaagtcgctgcacgaagac
ttcactggccagtcgggcatcgacctgaatcgcgccggtacgccgctgctcgagatcgtc
accgagcccgacatgcgctcgtccgcagaggccgtggcctatgcgcgcgagctgcacaag
atcgtcacctggatcggcatctgcgacggcaacatgcaggaagggtcgttccgctgcgac
gccaacgtttcggtgcgcaagcccggcgcagcgctgggcacgcggcgcgagatcaagaac
ctcaacagcttcaagagcatgcagcaggccatggattacgagatccgctggcagatcgag
gaaatcgaagatggccgcgccatcgagcaggccacggtgctgttcaaccccgacaccggc
gagacgcgtgccatgcgcagcaaggaagacgccgccgactaccgctactttcctgatccc
gacttgccgccgctggtcattgcggagcaatggatcgaggacattcgcgcgcacatgggc
gaactgccgcgtgccatggcggcgcgctttgttgccgactatggcgtgcccgaatacgac
gccgccatcctcacgcaaagcaaggccatggcggcgtactttgagcgtgcagcgcaggca
agcagccagcccaagctggcgagcaactggatcatgggcgaactcgcgcgccgcctcaat
gccgaggaacgctccattgagcaggcaccggtgggagccgagcaactggcgcaactgctg
cagcgcatcaacgatgccacggtgtccaacaacgccgcgcgacaggtcttcgaggcgctg
tggagcggcgcgggaagcgatgtggacgccctcatcgatttcctgggcctgcgccagatg
aacgacacgggtgcacttgaagccctggtggatcaggtgattgccgccaatgccgacaac
gtcgcccaataccgcgccggcaaggacaaggccttcaacgcgctggtggggcaggtgatg
aaggcgagcaaaggcaaggccaacccgcagcaggccactgatttgctgcgcaagcgcctc
gtgcgctga

DBGET integrated database retrieval system