KEGG   Simplicispira suum: C6571_08365
Entry
C6571_08365       CDS       T05361                                 

Definition
(GenBank) DUF2130 domain-containing protein
Organism
simp  Simplicispira suum
SSDB
Motif
Pfam: DUF2130 PKcGMP_CC zinc_ribbon_4 DUF4362
Other DBs
NCBI-ProteinID: AVO43148
UniProt: A0A2S0N4S6
LinkDB
Position
complement(1792103..1793509)
AA seq 468 aa
MHDIICPHCNKAFKVDETGYADILKQVRDADFHAQLHERLELAEQDKRNAVALAEAQVAH
ALQKAAAAKDTEIQALKARLDAGAVERDLAVAQALSAVEKQRDALAHELERARAAQQAAD
QLAQARLAQELQGVAAQKDAEIERLRSQLEAGEVARRLAVSEAVAVVVRERDELKNDLNL
AVVKKQLEEAAIKEQHALQLRDRDGEIARLRDMKARLSTKMVGETLEQHCETEFNRIRAT
AFAHAYFEKDNDARSGSKGDYIFRDLDESGNEIVSIMFEMKNESDQTATKKRNEDFLKEL
DKDRTEKGCEYAVLVSLLEPESELYTGIVDMSHRHPKMYVVRPQFFIPIITLLRNAAMKS
LQYKSELALVKAQNLDITRFETQLDEFKGAFGRNWRLASDGFEEAVRRIDEAIKDLEKTK
EALHKSANNLRLANDKAEDLTIKKLTRGNPTMAAKFAELKQAGISDGE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcacgacatcatctgcccccactgcaacaaggcgttcaaggtggacgaaaccggctat
gccgacatcctcaagcaggtgcgcgacgcggatttccacgcgcagttgcacgagcggctg
gagctggccgagcaggacaagcgcaatgcggtggcgctggccgaggcccaggtggcccat
gcgctgcagaaggcggcggccgccaaggacaccgagattcaggccctgaaggcccggttg
gatgcgggcgcggtggagcgcgatctggcggtggcgcaggccctgagcgcggtggaaaag
cagcgcgatgcgctggcccatgaactggaacgtgcgcgggcggcgcagcaggcggcggac
cagttggcacaagcgcggctggcgcaggagctgcaaggtgtggccgcgcaaaaggacgcc
gagatcgagcggctgaggtcgcagctggaggcgggcgaggtggcgcgcaggctggcggtg
tccgaggcggtcgcggtggtggtgcgggagcgcgatgagctcaagaacgacctgaacctg
gcggtggtgaagaagcagctggaggaggccgccatcaaggagcagcacgccttgcagctg
cgtgaccgcgacggcgagattgcgcgcctcagggacatgaaggcgcgcctgtcgaccaag
atggtgggcgagacgctggagcagcactgcgagacggagttcaaccgcatccgcgccacg
gcttttgcgcacgcgtatttcgagaaagacaacgacgcacgcagcggcagcaagggcgac
tacatctttcgcgacctggacgagtcgggcaacgaaatcgtctccatcatgttcgagatg
aagaacgagagcgaccagaccgccaccaagaagcgcaacgaagacttcttgaaagagctg
gacaaggaccgcaccgaaaaaggctgcgaatatgcggtgctggtgtcgctgctggagccc
gagagcgagctgtacacgggcatcgtggacatgtcgcaccgccaccccaagatgtacgtg
gtgcggccgcagttcttcatccccatcatcacgctgctgcgcaacgcggcgatgaagtcg
ctgcagtacaagtcggagctggcgctggtgaaggcgcaaaacctggacatcacccggttc
gagacgcagctcgacgagttcaagggcgccttcgggcgcaactggcgcctggcgtcggac
gggttcgaggaggcggttcggcgcatcgacgaggccatcaaggacctggagaagaccaag
gaggcgctgcacaagtcggccaacaacttgcgcctggccaacgacaaggccgaagacctg
accatcaagaagctgacacgcggcaacccgacgatggcggccaaatttgccgagctcaag
caggcggggatttcggacggtgaatga

DBGET integrated database retrieval system