KEGG   Simplicispira suum: C6571_09895Help
Entry
C6571_09895       CDS       T05361                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
simp  Simplicispira suum
Pathway
simp00061  Fatty acid biosynthesis
simp01100  Metabolic pathways
simp01212  Fatty acid metabolism
Module
simp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C6571_09895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:simp01004]
    C6571_09895
Enzymes [BR:simp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C6571_09895
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     C6571_09895
Lipid biosynthesis proteins [BR:simp01004]
 Fatty acid synthase
  Component type
   C6571_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AVO41559
UniProt: A0A2S0N0A0
LinkDB All DBs
Position
2129884..2130423
Genome map
AA seq 179 aa AA seqDB search
MADSFSYEQLIASGEGRLFSPDSGRLPLPPMLMFDRITHIDSDGGAHGLGRIRAELDVRP
DLWFFDCHFQGDPVMPGCLGLDAMWQLIGFYLTWLQLPGKGRALGAGEVKFTGEVGPDVK
LVTYEIDIKRVIKRKLVMAIGDARLLADGQEIYVASDLRVGLFKKDDAPAAAKATGETP
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcagattctttttcctacgaacaactgatcgcttcgggcgaaggccggcttttttca
cccgacagcggacgcctgcccttgccgccgatgctgatgttcgaccgcatcacgcacatc
gatagcgacggcggtgcgcatgggctggggaggatccgcgcggaacttgatgtgcgtccc
gatctgtggttttttgactgccatttccagggggatccagtgatgcctggctgcctgggc
ctggacgccatgtggcaattgatcggtttttacttgacctggctacagctgccgggcaag
ggccgtgcgctgggcgcgggcgaagtcaagttcacgggcgaagtggggcccgacgtcaaa
ctggtcacctacgagatcgacatcaagcgggtcatcaaacgcaagctggtgatggccatt
ggtgacgcccgcttgttggcggatggccaggaaatttacgtggcaagcgacctgcgtgtc
ggcctgttcaagaaggacgacgcgcccgccgctgcgaaagcgacaggagagactccatga

DBGET integrated database retrieval system