KEGG   Simplicispira suum: C6571_13760Help
Entry
C6571_13760       CDS       T05361                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
simp  Simplicispira suum
Brite
KEGG Orthology (KO) [BR:simp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6571_13760
Enzymes [BR:simp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C6571_13760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored DAO AlaDh_PNT_C HI0933_like NAD_binding_8 FAD_binding_3 Glutaredoxin NAD_binding_7 Thi4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AVO42212
UniProt: A0A2S0N237
LinkDB All DBs
Position
2960614..2962182
Genome map
AA seq 522 aa AA seqDB search
MLDDNLKTQLKAYLERLQRPVELVATLDDSATSNELRELLQDIRAQSDKITVVENNALDV
RKPSFLITNPGQDSGVRFAGVPLGHEFTSLVLALLQVGGHPSKEAADLLEQIKALEGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGGVFQKEIEAREVMGVPTVFLNGER
FGQGRMELAEVVAKLDTGAGARDAARLNAKEPFDVLIVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTVGIDNFLSVQHTEGPQFAAAMERHVRDYEVDIMNLQRATALVPASTEG
GLIEVQFENGASLKSRTVIVSTGARWRNMNVPGEEEYRTKGVTNCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVARVTVLEFAPELKADAVLQRKLLSMPNVTVITNAQTTQVVGD
GSKVTGLNYTDRATGEAQDIALEGIFVQIGLLPSTDWLKGTVELSRFGEVQIDGHGRTDV
PGVFAAGDCTTVPFKQIVIAAGDGAKAALSAFDHLIRTTAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacaacctcaagacccaattgaaagcctatctggagcgcctgcagcgcccg
gtggagctggtcgccacgctggacgacagcgctacgtcgaacgagctgcgcgaactgctg
caggacatccgcgcccagtcggacaagatcaccgtggtcgagaacaacgcgctggacgtg
cgcaaaccctcgttcctgatcaccaaccccggccaggacagcggcgtgcgctttgccggc
gtgccgctcggccacgaattcaccagcctcgtgctggcgctgttgcaggtcggcggccat
ccctcgaaggaagcggccgatctgctggagcagatcaaggcgctggagggcgacttccac
ttcgaaacctactactcgctctcgtgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtgttgaacccacgcatcacgcacaccgcgattgacggcggcgtgttccag
aaggaaatcgaagcgcgcgaagtcatgggcgtgcctaccgtgtttctgaacggcgagcgc
tttggccagggccgcatggagttggccgaagtggtcgccaagctcgacaccggcgctggt
gctcgcgacgcggccaggctcaatgccaaggagccgtttgatgtgctgatcgtcggcggc
ggcccggccggcgcggccgcggcggtgtatgcggcgcgcaaaggcattcgcaccggcgtg
gccgccgagcgctttggcggccaggtgctcgacaccgtaggcatcgacaactttctctcg
gtgcaacacaccgagggcccgcaattcgccgccgccatggagcgccatgtacgcgactac
gaggtggacatcatgaacctgcagcgcgccacggccttggttccggccagcaccgagggc
gggctgatcgaggtgcagttcgagaatggggcgagcctcaagagccgcaccgtcatcgtc
tcgaccggcgcgcgctggcgcaacatgaacgtgccgggcgaggaggaataccgcaccaag
ggcgtcaccaactgcccgcactgcgacggcccgctgttcaagggcaagcatgtggcggtg
attggcggcggcaactcgggcgttgaagcggcgattgacctcgccggggtggtcgcccgc
gtcaccgtgctggaatttgcgccagaactcaaggccgacgcggtgctgcagagaaagctc
ctgagcatgcccaacgtcaccgtcatcaccaacgcgcaaaccacgcaggtggtgggcgac
ggcagcaaggtcaccggactgaactacaccgaccgcgccaccggcgaagcgcaggacatc
gcgctcgaaggcatcttcgtgcagattggcctgttgcccagcaccgactggctcaagggc
acggtggaactgtcgcgctttggcgaagtccagatcgacggccacggccgtaccgacgtg
ccgggcgtgttcgctgccggcgactgcaccacggtgccgttcaagcagatcgtgattgcg
gcgggcgatggagcgaaggcagcgctgagtgcctttgatcacttgattcgtaccacggcg
ccggcttga

DBGET integrated database retrieval system