KEGG   Simplicispira suum: C6571_14310Help
Entry
C6571_14310       CDS       T05361                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
simp  Simplicispira suum
Pathway
simp00061  Fatty acid biosynthesis
simp00780  Biotin metabolism
simp01100  Metabolic pathways
simp01130  Biosynthesis of antibiotics
simp01212  Fatty acid metabolism
Module
simp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C6571_14310
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C6571_14310
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C6571_14310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:simp01004]
    C6571_14310
Enzymes [BR:simp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     C6571_14310
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     C6571_14310
Lipid biosynthesis proteins [BR:simp01004]
 Fatty acid synthase
  Component type
   C6571_14310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AVO42311
UniProt: A0A2S0N2W6
LinkDB All DBs
Position
complement(3076347..3077135)
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKKLLITGVLSNRSIAYGIARACHQQGAELAFSYVGERFKDRITEFAAEFDSKLV
FDCDVASDEQIERMFRELSATWPTLDGFVHSIGFAPREAIAGDFLEGLSREGFRVAHDIS
AYSFPAMAKAALPYLNDKSALLTLSYLGALRTIPNYNTMGLAKASLEASVRYLAEALGPK
GMRVNGISAGPIKTLAASGIKDFGKLLSGVASASPLRRNVTIEDVGNVAAFLMSDLASGM
TAEITYVDGGFSQTAGISRDMV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcacgggcaagaagttgctgattaccggcgtgctgtccaaccgctccatt
gcctacggcattgcacgcgcctgccaccagcagggcgctgagctggccttcagctacgtc
ggcgagcgcttcaaggaccgcatcaccgaattcgcagcggagttcgactccaagctggtg
ttcgattgcgacgtggccagcgacgagcagatcgagcgcatgttccgcgaactttcggcc
acgtggcccacgctcgatggctttgtgcacagcattggctttgccccacgcgaagccatc
gctggcgacttcctcgaaggcctctcgcgcgaaggctttcgcgtggcgcacgacatcagc
gcctacagctttccggcgatggccaaggccgccctgccctacctgaacgacaagtcggcc
ctgctgacgctgtcgtacctgggcgcgctgcgcaccattcccaactacaacaccatgggc
ctggccaaggccagcctggaagccagcgtgcggtatctggccgaagcgctcggtcccaag
ggcatgcgcgtcaacggcatcagcgccgggcctatcaagacgctggcggccagtggcatc
aaagatttcggcaagctgctcagcggcgttgccagtgcctcgcccttacgccgcaacgtg
accattgaagacgtgggcaatgtcgccgccttcctgatgagcgacctcgccagcggcatg
accgccgaaatcacctacgtggatggcggcttcagccagacggcaggcatcagccgcgac
atggtgtaa

DBGET integrated database retrieval system