KEGG   Simplicispira suum: C6571_16890Help
Entry
C6571_16890       CDS       T05361                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
simp  Simplicispira suum
Brite
Enzymes [BR:simp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C6571_16890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AVO43338
UniProt: A0A2S0N5A7
LinkDB All DBs
Position
3637528..3638010
Genome map
AA seq 160 aa AA seqDB search
MPGHGAMHAPSATARLEPTRGNQVSGSVRFTQMGEQLQLRGDIKGLAPHSEHGFHVHEKG
DCSSGDGNSAGGHFNPHNTRHGMAMGAEHHTGDLPSIRANAQGVAHIDVKITGVRVGSGM
DDIVGRGLIVHRDPDDFMTQPTGDAGPRLACGVIRRDGLG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccacggcgctatgcacgcgcccagtgccacggcgcggttggaaccgacgcgc
ggcaaccaggtaagcggcagcgtgcgtttcacccagatgggcgagcagctgcagttgcgc
ggcgacatcaaaggcctggcgccccattccgaacacggctttcatgtgcacgaaaagggc
gactgctccagcggcgacggcaacagtgccggtggccacttcaacccgcacaacacccgg
cacggcatggccatgggcgcagagcaccacaccggcgacttgcccagcattcgcgccaat
gcgcagggcgtagcgcacatcgacgtcaagatcactggcgtgcgcgtaggcagcggtatg
gacgacatcgttggccgtggcctgatcgtgcaccgcgacccggacgatttcatgacccag
cccaccggcgacgccggcccgcgcctggcctgcggggtgattcggcgcgatggattagga
taa

DBGET integrated database retrieval system