KEGG   Simplicispira suum: C6571_19105
Entry
C6571_19105       CDS       T05361                                 

Definition
(GenBank) 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
simp  Simplicispira suum
Pathway
simp00362  Benzoate degradation
simp00622  Xylene degradation
simp00643  Styrene degradation
simp01100  Metabolic pathways
simp01120  Microbial metabolism in diverse environments
simp01220  Degradation of aromatic compounds
Module
simp_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:simp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C6571_19105
   00622 Xylene degradation
    C6571_19105
   00643 Styrene degradation
    C6571_19105
Enzymes [BR:simp01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     C6571_19105
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Esterase Abhydrolase_3 BAAT_C DUF1100 Esterase_PHB Ndr Abhydrolase_4 FSH1
Other DBs
NCBI-ProteinID: AVO43542
UniProt: A0A2S0N5W9
LinkDB
Position
unnamed2:complement(40941..41777)
AA seq 278 aa
MTTISPEIGQSIVASGIRTNYHDLGQGSPVVLIHGSGPGVSGWANWRLALPKLAERRRAL
ALDMAGFGYSDPSLDGSYSLNLWVQQTVGFLDALDLKQVDLVGNSFGGAIALALAIRYPE
RVRRMVLMGAAGLKFELTPALDAVWGYTPSVENMKAVMAWFAYDDSLMSDDLARMRYEAS
VRKGVQEAYAAMFPAPRQRWIEALASPEDSIRALLHETLVIHGREDRVVPVANSMRLSQM
IPRAQLHVFGQCGHWTQIEHGGRFVRLVNDFLAEADVA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgactactatttcccccgaaatcggccaatccattgtggcgagcggcatccgaacgaac
taccacgacctcgggcaaggctcgccggtggtgctcattcacgggtctggcccgggcgtg
agcggctgggccaactggcgacttgcgcttccgaagctggctgaacggcgtcgcgcgcta
gcacttgacatggctgggttcggttacagcgaccccagtctggacggcagctattcgctg
aacctatgggttcagcagacagtagggttcctcgacgctctcgacctgaagcaagtcgac
ctggttggcaactccttcggtggtgcaatcgcgctggcgctcgcaattcgctaccccgaa
cgcgtgcgcaggatggttctcatgggcgcggctggcctcaaattcgaactgacgccggcg
ctggacgcggtctggggctacacgccatcggtcgaaaatatgaaagctgtcatggcgtgg
ttcgcctacgacgactcgctcatgagcgacgatctcgcgcgcatgcgatacgaagcgagc
gtgcgcaaaggcgtgcaagaagcgtatgcagcgatgtttcccgcgccgcggcagcgctgg
attgaggcgctggcgagccccgaggacagcatccgcgcgctgctccacgaaacattggtg
attcatggccgcgaagatcgtgtcgtgccggtagccaattcgatgcggttgtcgcagatg
atcccgcgcgcccagctccacgtgttcggccagtgcggccactggacgcaaatcgagcat
ggtggccgcttcgtgcgattggtgaacgactttttggcagaagcggatgtcgcctga

DBGET integrated database retrieval system