KEGG   Sulfolobus islandicus Y.N.15.51: YN1551_1480Help
Entry
YN1551_1480       CDS       T00902                                 

Definition
(GenBank) MCM family protein
  KO
K10726  replicative DNA helicase Mcm [EC:3.6.4.-]
Organism
sin  Sulfolobus islandicus Y.N.15.51
Pathway
sin03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sin00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YN1551_1480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sin03032]
    YN1551_1480
Enzymes [BR:sin01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     YN1551_1480
DNA replication proteins [BR:sin03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    YN1551_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_5 Mg_chelatase AAA_3 Sigma54_activat DUF3987
Motif
Other DBs
NCBI-ProteinID: ACP48570
UniProt: C3NHG0
LinkDB All DBs
Position
1292932..1294992
Genome map
AA seq 686 aa AA seqDB search
MEIPSKQIDYRDLFIEFLTTFKNTNNQNKYIERINELIAYRKKSLIVEFSDILSFNENLA
YEIINNTKIVLPILEGALYDHILQLDPTYQRDIEKVHVRIVGIPRVIELRKIRSTDIDKL
IAIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDEEMPEILEMPTICPKCGKPGQF
RLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILEIK
QDSPIKRGSRAVFDIYMKVSSIEVSQKVLDEVTISEEDEKKIKDLAKDPWIRDRIIASIA
PSIYGHWELKEALALALFGGVPKVLEDTRIRGDIHILIIGDPGTAKSQMLQFISRVAPRA
VYTTGKGSTAAGLTAAVVREKGTGEYYLEAGALVLADGGIAVIDEIDKMRDEDRVAIHEA
MEQQTVSIAKAGIVAKLNARAAVIAAGNPKFGRYITERPVSDNINLPPTVLSRFDLIFIL
KDQPGEQDRELANYILDVHSGKSTKNIIDIDTLRKYIAYARKYIIPKITSEAKNLITDFF
VEMRKKSSETPDSPILITPRQLEALIRISEAYAKMALKTEVTREDAERAINIMRLFLESV
GVDMESGKIDIDTIMTGKPKSAREKMMKILEIIDSLAVSSECAKVKDILKEAQQVGIEKS
NIEKLLTDMRKSGIIYEAKPECYKKV
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
ttggaaattcctagcaaacagattgactatagagacctctttatagaatttctaacaact
ttcaagaataccaacaatcagaacaaatatattgagagaataaatgaactaatagcgtat
aggaaaaaaagtcttatagtagaattttccgatatactctcattcaacgaaaatctagct
tatgagataataaataacaccaaaatcgttctaccgattctagaaggtgcattatatgat
catatcctacaattggatcctacatatcagcgagatatagaaaaggttcacgttagaatt
gtaggaatacctagagttatagaacttagaaaaataagaagtactgatatagataaacta
atagccattgatggaatactagttaaagttactccggtaaaagaaagaatttacaaggca
acctataagcacattcacccagactgcatgcaagagtttgagtggccagaggatgaagag
atgccagaaatattagagatgccaaccatatgtccaaaatgtggtaagccgggacaattc
aggctaatcccagagaaaacaaagttaattgattggcaaaaagcggtaatccaggagaga
ccagaagaagtaccttccgggcagttacctaggcagttagaaataatccttgaagacgat
ttagttgattctgcaaggccaggggatagagtaaaagtaactggaattttagagataaaa
caagactctccaattaaaagaggaagtagagcggtattcgacatttatatgaaagttagt
agcatagaagtttcacaaaaagtactagatgaagtaacaatctctgaagaagatgagaaa
aagatcaaggacttagctaaggatccttggatacgtgatagaattatagcatcgatagcg
ccatctatttatggtcattgggaattaaaggaagctctagcattagcattatttggagga
gttcctaaggttctagaagatacaagaataagaggagatattcacattttaataataggt
gatcccggtaccgccaaatcacaaatgctacagtttatctcgagagtagctccaagggca
gtttacacaactggtaaaggatccacagctgcaggcttaacagctgcagtagtgagagaa
aagggaactggagaatattacttagaagctggtgcgttagtgttagctgatggtggaata
gctgtaatagatgaaatagataagatgagagacgaagatagagtagccattcatgaagca
atggaacagcaaacagtttccatagcgaaagctggaatagtagctaaattaaacgctaga
gctgcagttattgctgcgggaaatccaaaatttggtagatatataaccgaaaggccagta
tctgataatattaacttacctcccacagtcttatcaagatttgacctaatattcatatta
aaggatcaaccaggtgaacaagatagagagcttgcaaactatatattagatgtacattca
ggaaaatctacaaaaaatattatagatatagatacattaagaaaatatatagcgtatgca
aggaaatatattataccaaaaattacgagtgaagctaagaatctaattacagacttcttc
gtggagatgaggaagaaaagttcggaaactcccgatagcccaatattgataactccaaga
caattagaggctttaataagaatttcagaagcttatgctaaaatggctctcaaaacagaa
gtcaccagagaggatgcagaaagagccataaatataatgagactattcctagaaagcgta
ggagttgacatggaaagtggaaaaatagatatagatacgataatgactggaaaacctaaa
agtgctagagagaaaatgatgaaaatactagaaataatagatagcttagcagtaagttca
gagtgtgcaaaggttaaggatatactaaaagaagcacaacaagttggtatcgaaaaaagt
aacatagaaaaattacttacagatatgagaaaaagtggtataatatacgaagcaaaacca
gaatgttacaaaaaagtctaa

DBGET integrated database retrieval system