KEGG   Sphingobium indicum: SIDU_00905Help
Entry
SIDU_00905        CDS       T04604                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sinb  Sphingobium indicum
Pathway
sinb00473  D-Alanine metabolism
sinb00550  Peptidoglycan biosynthesis
sinb01100  Metabolic pathways
sinb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SIDU_00905
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SIDU_00905
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SIDU_00905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sinb01011]
    SIDU_00905
Enzymes [BR:sinb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SIDU_00905
Peptidoglycan biosynthesis and degradation proteins [BR:sinb01011]
 Precursor biosynthesis
  Amino acid ligase
   SIDU_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: APL93202
UniProt: A0A1L5BK54
LinkDB All DBs
Position
177702..178667
Genome map
AA seq 321 aa AA seqDB search
MTRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHRVTRIDMDRDVALRLSETRPDV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGHIV
PSESLFEGDPLPRPYVVKPVNEGSSVGVAIVTEGGNYGSPIGRDVEGPWLHFDELLAEPY
IRGRELTTAVLGDEALLVTELRPKSGFYDFDAKYTDGMTEHVCPADIPPEIGEACKAIAL
RAHQLLGCKGASRSDFRWDDEQGIEGLFLLEVNTQPGMTPLSLVPEQAARLGIDYAELVE
RIVEDALNGARTAANGGAKHG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtggcccctggcatgtagccgtcctgatgggcggctggtccgccgagcggccg
gtttcgctctcgtcgggcgagggcgtcgccaaggcgctggaatcgcgcggccacagggtc
acgcgcatcgacatggaccgcgacgtcgcgctgcggctctccgaaacccgacccgatgtc
gtgttcaacgccctccacggcgttccgggcgaggatggcacggtacagggcatgatggac
ctgatgggcctcacctacacccattcgggcctcgccacctcggtcatcgccatcgacaag
cagcttaccaagcaggcgctggtgccccacggcatccccatgcccggcggtcatatcgtc
cccagcgaaagcctgttcgagggtgatccgctgccgcgtccctatgtggtgaagccggtc
aatgagggcagttcggtcggcgtcgccatcgtgacggaggggggcaattacggttcgccc
atcggccgcgatgtcgagggcccctggttgcatttcgatgagttgctggccgaaccctat
attcgcgggagggaactgaccaccgccgtgctcggcgacgaagcgctgctggtgacggaa
ttgcgtcccaaaagcggcttctacgatttcgacgccaaatataccgacggcatgaccgag
catgtctgccccgccgatattccgccggagatcggcgaagcctgcaaggccatcgcgctg
cgcgcgcaccagttgctggggtgcaagggcgcttcgcgctccgatttccgttgggatgac
gagcagggcatcgaggggctgttcctgctggaagtgaacacccagccgggcatgacgccg
ctcagcctggtccccgaacaggcggccaggctgggcattgactatgccgaactggtggag
cgtatagtcgaggacgcgctgaacggcgcccgaactgcagccaatgggggagcgaagcat
ggctga

DBGET integrated database retrieval system