KEGG   Sphingobium indicum: SIDU_01485Help
Entry
SIDU_01485        CDS       T04604                                 

Definition
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_01485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_01485
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     SIDU_01485
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SIDU_01485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-ProteinID: APL93300
UniProt: A0A1L5BK74
LinkDB All DBs
Position
294890..295660
Genome map
AA seq 256 aa AA seqDB search
MRIATFNINGIKARLPRLLEWLDETRPDIACLQEIKTSDDTFPVRDIEDVGYGAIWHGQK
GFNGVAILARGETPVEVRRGLEGEPEDEHSRYLEADVKGLRVASIYLPNGNPQPGPKFDY
KLRWMKRLRDRAAQIWAEEVPAILAGDYNVIPRDRDVYSVKAMAEDALMQPESRAAYRRL
LGDGWTDAIASRHPAGGVWTYWDYQMNAWPRDAGFRIDHLLLSPAAADRLIDAQVDKDFR
GREKASDHAPTWVELS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgccaccttcaacatcaacgggatcaaggcgcgcctgccgcgcctgctggag
tggctggacgagacgcgccccgacatcgcctgcctgcaggagatcaagacatccgacgac
acgttcccggtcagggatattgaggatgtcggctatggcgcgatctggcacgggcaaaag
gggttcaacggggtcgcgatactggcgcggggagagacgccggtggaggtccgccggggc
ctggagggggagccggaggacgagcatagccgctatctggaagccgatgtgaaggggctg
cgcgtcgccagcatctacctgcccaacggcaatccgcagccggggccgaaattcgactac
aagctgcgctggatgaagcgcctgcgcgaccgcgccgcgcaaatctgggcggaggaagtg
ccggcgatcctggcgggcgattacaacgtcattccgcgcgacagggacgtctattcggtc
aaggcgatggccgaagacgcgctgatgcagcccgaaagccgcgccgcctatcgccgcctg
ttgggcgacggatggaccgacgccatcgcttcccggcatccggcgggcggggtatggacc
tattgggactatcagatgaacgcctggccgcgcgacgcggggttccggatcgatcacctg
ctgctcagtcccgccgccgccgaccggctgatcgacgcgcaggtcgacaaggatttccga
gggcgggaaaaggcgagcgaccatgccccgacctgggtggaactgtcgtaa

KEGG   Sphingobium indicum: SIDU_15860Help
Entry
SIDU_15860        CDS       T04604                                 

Definition
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_15860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_15860
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     SIDU_15860
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     SIDU_15860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-ProteinID: APL95862
UniProt: A0A1L5BSV1
LinkDB All DBs
Position
3331029..3331826
Genome map
AA seq 265 aa AA seqDB search
MSQTLSIASWNINSVRARLDIVERFLTEESPDILCLQETKVVNDTFPAGLFRQRGYNHQV
LNGQPMHHGVAILSKIPIREDDRLDWQANGEARHVGVRLDNGVRIENVYVPAGGDVPDRE
VNPKFGQKLDFLERMIQWSSTLEDKPTILTGDFNIAPMECDVWSHKQLLNVVSHTPIECE
ILARLQESNDWVDIGRKFYPAPQRLYTWWSYRARDWAESDRGRRLDHMWMTRDVAEKAVS
HRVVEPIRGWSRPSDHVPIITEFAF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagacgctcagcatcgcttcgtggaatatcaacagcgttcgtgcccggctcgac
attgtcgagcgctttctgacggaagaatcgcccgacatattgtgtctgcaggaaacgaag
gtggtgaacgacaccttcccggcggggctgttccggcaacggggctataatcatcaggtg
ctgaacggacagccgatgcaccatggcgtggcgatcctgtcgaagattccgatccgggag
gacgaccggctcgactggcaggccaatggggaggcgcgccatgtcggcgtgcggctggac
aatggggtcaggatcgagaatgtctacgtgcccgccggcggcgacgtgccggatcgggag
gtcaatccgaaattcgggcagaagctcgacttcctggagcgcatgatccaatggtcctcc
acgctggaggacaagccgaccatcctgaccggcgatttcaacatcgcgccgatggaatgc
gacgtgtggagccacaagcagcttttgaacgtcgtcagccatacgcccatcgaatgcgag
attctggcgcgcttgcaggaatcgaacgattgggtcgacatcggccgcaaattctacccc
gcgccgcagcggctctacacctggtggagctatcgcgcgcgcgactgggcggaatcggat
cgcggacggcggctcgaccatatgtggatgacgcgggacgtcgcggaaaaggcggtcagc
caccgcgtcgtcgagccgattcgcggctggtcgcggccgtccgaccatgtgccgatcatc
acggaattcgccttctga

DBGET integrated database retrieval system