KEGG   Sphingobium indicum: SIDU_04410Help
Entry
SIDU_04410        CDS       T04604                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_04410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_04410
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SIDU_04410
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_04410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DUF4918
Motif
Other DBs
NCBI-ProteinID: APL96235
UniProt: A0A1L5BTQ0
LinkDB All DBs
Position
926392..927045
Genome map
AA seq 217 aa AA seqDB search
MTLQSPIPHGEAPHDCPLCPRLAVLRERNRAEHPGWWNAPVPHFGDPLGRIAIVGLAPGR
MGANRTGRPFTGDHAGDLLFATLAKFGLANGVYEARADDGLTLRGAIILNAVKCLPPQNR
PLPEEVHNCRAFLKAAVEALPHAQVFLALGQIAHQSTVKALGGKLPKARFAHMAEHRMPS
GKIVIDSYHCSRYNQNTGRLTARMFEAVFARALALSE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcaaagtcctatcccgcatggcgaggcgccccacgattgcccgctttgcccg
cgcctggccgttttgcgcgaacggaaccgggcggaacatcccggctggtggaacgcgccg
gtcccgcatttcggcgatccgctcggccggatcgcgattgtcggcctggcgcccggcagg
atgggcgccaaccgcacgggccggcccttcaccggggatcatgccggcgatctgctcttt
gccaccctcgccaagttcggcctcgccaacggcgtctatgaagcgcgcgccgacgacggc
ctgacattgcgcggcgccatcatcctcaacgcggtcaaatgcctgccgccgcagaacagg
ccactgccggaggaggtccacaattgccgcgccttcctgaaggccgcggtggaggccctg
ccccacgcgcaggtcttcctcgccctgggtcagatcgcgcatcagtcgacggtcaaggcg
ctgggcggcaagctccccaaggcgcgcttcgcccatatggcggagcatcgcatgcccagc
ggcaagatcgtcatcgatagctatcattgttcgcggtacaaccagaataccgggcgattg
acggctcggatgttcgaggccgtcttcgcccgggcgctggcgctcagcgaatga

KEGG   Sphingobium indicum: SIDU_05670Help
Entry
SIDU_05670        CDS       T04604                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_05670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_05670
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SIDU_05670
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: APL94035
UniProt: A0A1L5BMC1
LinkDB All DBs
Position
complement(1207175..1207879)
Genome map
AA seq 234 aa AA seqDB search
MRENLADAANAYMAWWSLAGVDCAMGEEPTNWLRPLQQSARIRAAVPEDGPAQPRPHSLE
SFLTWLAQDAAQPERRWPGAAIMPAGPVDAPLMVITDMPDPVDIGAGTLLSDRAGQLFDA
MLRAIGLQRQDVHLASLFLSRPPGAMVEASDLAAAAARMRTYVMLAAPRRLLLLGDRTIR
ALLPAADSGSRVFNHDGGTLPVFATFHPRLLLGQPAAKAECWHVLQGLIEEMAK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaaatctggcggacgccgccaatgcctatatggcgtggtggagcctggccggc
gtggattgcgccatgggggaggagccgaccaattggctgcgtccccttcaacagtcggcg
cggatacgcgctgccgttcccgaagacggtcccgcccagccgaggccccattcgctcgaa
tccttcctgacctggcttgcgcaggatgccgcgcagccggaacggcgctggccgggcgcc
gcgatcatgcccgccggacccgtcgacgcgccgctcatggtcatcaccgacatgcccgat
ccggtggacatcggcgccggaacgctgctcagcgatcgcgcgggacagttgttcgacgcc
atgttgcgggccatcgggctccaacggcaggacgtccacctcgcgtccctcttcctgtcc
cgcccgccgggcgcgatggtggaggcgtcggacctggcggcggccgcggcgcgcatgcgc
acatatgtgatgcttgccgccccgcgaagattgctgttgttgggcgaccggacgatccgc
gccctgttgcccgccgcggattcaggttcacgggtttttaaccatgacggcggcacctta
cccgtcttcgccacatttcacccgcgtttgctgcttggccagcccgcggcaaaggcggaa
tgttggcatgtgctgcaaggtctgatcgaggaaatggctaagtga

KEGG   Sphingobium indicum: SIDU_10490Help
Entry
SIDU_10490        CDS       T04604                                 

Definition
(GenBank) DNA polymerase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_10490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_10490
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SIDU_10490
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4130 UDG
Motif
Other DBs
NCBI-ProteinID: APL94906
UniProt: A0A1L5BPW1
LinkDB All DBs
Position
2187581..2188975
Genome map
AA seq 464 aa AA seqDB search
MHRARLNGPDDFDGWRVAARAFALAGTKPADILWQTGDEGDLFAADEAPPPVGEVAFSVP
RAFVELAERAILHRDAERFALLYALLVQLRDRPASLEDRADPLVRRVEALAKAVRRDMHK
MRAFVRFRELADAEGPRFVAWFEPDHHIVRANAGFFARRFASMRWSILTPELSIHWDGDA
LTEGPGATRRDAPAQDPVEDIWKGYYAAIFNPARLKVGAMLSEMPRKYWRNLPEAALIPE
LVAGAQSREAAMIATPPKPSARQGNAAAAWSALREEAMGCTRCPLYRDTTQTVFGEGPVD
APLMFIGEQPGDQEDLAGRPFVGPAGQLFDYALEEAGIDRRRAYITNAVKHFKHERRGKR
RIHQTPETPEIQACRWWLTQELELVRPRIIVALGATAGRALLGKAVTISRVRGAPIALES
GAQGWITVHPSYLLRVPDEARKMEERKRFVAELREIGEQVKVLA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgcgcggctgaacggaccggatgatttcgacggttggcgcgtggccgcgcgc
gccttcgccctcgccggcacgaagccagccgacatcctctggcagacaggggatgaaggc
gatctcttcgcggcggacgaagcgcctccgcccgtaggcgaggtcgccttttccgttccg
cgcgcctttgtcgaactggcggaaagggcaatcctgcaccgcgatgcggagcgtttcgcc
ctgctctacgccctgctcgtccaattgcgcgaccgccccgccagcctggaggatcgtgcc
gacccgctggtccgccgggtggaggccttggccaaggcggtgcggcgcgacatgcacaag
atgcgcgccttcgtccgcttccgcgaactggccgatgcggaggggcctcgcttcgtcgcc
tggttcgagccggaccatcatatcgtccgcgccaatgccggattcttcgcgcgccgtttc
gcctcgatgcgctggtcgatcctgacgccggaactcagcatccattgggacggcgatgcg
ttgaccgaaggaccgggcgccacccgccgggatgcgcccgcgcaagacccggtcgaggac
atctggaagggctattatgcggcgatcttcaatccggcgcggctcaaggtcggcgcgatg
ctgtccgaaatgccccggaaatattggcgcaacctgcccgaagccgcgctcatcccggag
cttgtggcaggcgcccagtcacgggaggcggccatgatcgcgacgccgcccaagccttcc
gcccggcaggggaacgccgcggcggcctggagcgcgctgcgggaggaggcgatgggttgc
acccgctgcccgctctaccgcgacacgacccagacggtgttcggagaagggccggtcgac
gccccgcttatgttcatcggggaacagcccggcgatcaggaggatctggccgggcgcccc
tttgtcgggccggccgggcaattgttcgactatgcgctggaggaggcggggatcgaccgc
aggcgcgcctacatcaccaacgccgtcaagcatttcaagcatgagcggcgcggcaagagg
cgcatccaccagacgcccgaaacgccggaaatccaggcatgccgctggtggctgacgcag
gagctggagctggtccggccccggattatcgtcgcgctcggcgccacggcggggcgggcg
ctgctggggaaggcggtgacgatcagccgcgtccgcggcgcgcccatcgccctggagagc
ggcgcgcagggctggatcacggtgcatcccagctatttgctgagggtgccggatgaggct
cgcaagatggaggagagaaagcgcttcgtcgcggaactgcgggagattggagagcaggtg
aaggtgctcgcctga

DBGET integrated database retrieval system