KEGG   Sphingobium indicum: SIDU_05735Help
Entry
SIDU_05735        CDS       T04604                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sinb  Sphingobium indicum
Pathway
sinb03030  DNA replication
sinb03410  Base excision repair
sinb03420  Nucleotide excision repair
sinb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SIDU_05735
   03410 Base excision repair
    SIDU_05735
   03420 Nucleotide excision repair
    SIDU_05735
   03430 Mismatch repair
    SIDU_05735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sinb03032]
    SIDU_05735
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_05735
Enzymes [BR:sinb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SIDU_05735
    6.5.1.6  DNA ligase (ATP or NAD+)
     SIDU_05735
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SIDU_05735
DNA replication proteins [BR:sinb03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    SIDU_05735
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     SIDU_05735
DNA repair and recombination proteins [BR:sinb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SIDU_05735
   NER (nucleotide excision repair)
    Other NER factors
     SIDU_05735
   MMR (mismatch excision repair)
    Other MMR factors
     SIDU_05735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: APL94048
UniProt: A0A1L5BMI4
LinkDB All DBs
Position
complement(1220977..1222560)
Genome map
AA seq 527 aa AA seqDB search
MRAFSQLLDGLVYTRSRNGKLDLIAAYMRSAPDPDRGWALAALTGNLDLKAVKASTIAEM
TRARVDPVLFEMSRDYVGDLAETVALLWPKAEDQPPEVDDGSLTLSAIIDRLHATSRAAA
PAILARMMDHLDASGRFALLKLATGGLRVGISARLAKTGFAQAFNLDVDDVEECWHALAP
PYAALFQWAEGKAERPDPAGTPFFRPFMLAHPLEAESVDLTDYAAEWKWDGIRVQIVGTP
GETRLYSRAGDDITGSFPDIAQALRHHAVLDGELLVKGEFQGGEAASFNALQQRLGRKAV
TAKMMDDYPAFVRLYDILLDADEDLRPLPWEQRRARLESIVPQLDPHRFDLSALIEAPDF
HALADIRAGARDAAIEGVMLKRRDSPYVAGRKAALWYKWKRDPLTADCVMMYAQRGHGKR
SSFYSDYTFGCWTEEGELLPVGKAYSGFTDEELKWLDRFVRTNTVNRFGPVREVEKSLVL
EVAFDSIHESRRHKSGLAMRFPRISRIRRDKPAHEADSIAGLRRFLI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttctcccaactcctcgacggcctggtctacacccgctcccgcaacggcaag
ctggacctcattgccgcctatatgcgcagcgcccccgaccccgaccggggctgggcgctc
gccgccctcaccggcaatctggacctgaaggcggtcaaggcttccaccatcgccgaaatg
acccgcgcccgcgtcgaccccgtcctgttcgaaatgagccgcgactatgtcggcgacctg
gccgaaaccgtcgccctgctctggcccaaggccgaagaccagccgccggaggtcgacgac
ggctccctcaccctctccgccatcatagaccggctccacgccaccagccgcgccgccgcc
cccgcgatcctcgcccggatgatggatcatctcgatgcctccggccgcttcgccctgctc
aagctggcgaccggcggcctgcgcgtcggcatctccgcccgcctcgccaagaccggcttc
gcgcaggccttcaacctcgacgtcgacgatgtggaggaatgctggcacgccctcgccccg
ccctatgccgccctcttccaatgggcagaggggaaggcggagcgtcccgacccggcgggc
acgcccttcttccgccccttcatgctcgcccacccgctggaggcggaaagcgtcgacctc
accgactatgccgccgaatggaaatgggacggcatccgcgtccagatcgtcggcacgccc
ggcgaaacccgcctctacagccgcgccggggacgacatcaccggcagcttccccgacata
gcgcaggcgctgcgccatcatgccgtccttgacggcgaactgctggtgaagggcgaattc
cagggaggcgaagcggccagcttcaacgccctccagcaacggctgggccgcaaggcggtg
acggcgaagatgatggacgactatcccgccttcgtccgcctctacgacatattgctggac
gccgacgaagacctccgcccgctgccgtgggaacaacgccgcgcccggctggaaagcatc
gtcccgcaactcgacccgcaccgcttcgatctgtccgccctgatcgaagcgcccgatttc
cacgcactcgccgacatccgcgcaggcgcccgcgacgccgccatagagggcgtgatgctc
aaacgccgcgacagcccctatgtcgcggggcgaaaggccgcgctctggtataaatggaaa
cgcgacccgctgaccgccgactgcgtgatgatgtacgcgcagcgcggccacggcaaacgc
tcatccttctattccgactacaccttcggctgctggacggaggagggcgaactgctgccc
gtgggaaaggcgtatagcggcttcaccgacgaggaactgaaatggctcgaccgcttcgtg
cggaccaacacggtcaaccgtttcggcccggtgcgggaggtggaaaagtcgctggtgctg
gaggtcgccttcgacagcatccacgaaagcaggcggcacaagtccggcctcgccatgcgc
tttccccgcatatcccgcatccgccgcgacaagccggcgcatgaagcggacagcatcgcc
ggcctcaggcggttcctgatctga

DBGET integrated database retrieval system