KEGG   Sphingobium indicum: SIDU_08060Help
Entry
SIDU_08060        CDS       T04604                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sinb  Sphingobium indicum
Pathway
sinb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SIDU_08060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sinb02000]
    SIDU_08060
Enzymes [BR:sinb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SIDU_08060
Transporters [BR:sinb02000]
 Other Transporters
  Pores ion channels [TC:1]
   SIDU_08060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C DSX_dimer GST_C_3
Motif
Other DBs
NCBI-ProteinID: APL94455
UniProt: A0A1L5BNI2
LinkDB All DBs
Position
1690102..1690731
Genome map
AA seq 209 aa AA seqDB search
MAETITLYTNPMSRGQIARWMLEEVGQPYEMVVLDYGEGGMKSADYLAINSMGKVPAIVH
GGRTITECAAICAYLADAFPAANLAPPTDRRADYYRWLFFAAGPVEAAVINKALGFVVPE
GRERTAGYGTFDTMVDTLEHAVSGPGWICGGQFTAADVYVGSQIDWGLTFGTIPSRPVFE
AYAARLRERPAYKRQKEMDNALIAQMQKP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccattaccctctacaccaacccgatgtcgcggggacagatcgcccgctgg
atgctggaggaggtcggccaaccctatgagatggtcgtgctggattatggcgaaggcggc
atgaagtccgccgattatctggcgatcaattcgatgggcaaggttcccgccatcgtccat
ggcggcaggacgatcacggaatgcgcggcgatctgcgcctatctggcggacgcctttccc
gccgcgaacctcgcgccgccgacggacaggcgcgccgactattatcgctggctgtttttc
gccgccggcccggtggaagcggccgtcatcaacaaggcgctcggcttcgtcgttcccgaa
ggccgggaacgaacggcgggctacggcacgttcgacaccatggtcgacacgctggaacat
gccgtctcaggccccggctggatttgcggcggccagttcaccgccgccgacgtctatgtc
ggttcgcagatcgactggggcctgaccttcggcacgatccccagccgccccgtcttcgaa
gcctatgccgcccgcctgcgcgaacgcccggcctataaacggcagaaggagatggacaac
gccctcatcgcccagatgcaaaaaccttaa

DBGET integrated database retrieval system