KEGG   Sphingobium indicum: SIDU_09720Help
Entry
SIDU_09720        CDS       T04604                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_09720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_09720
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SIDU_09720
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SIDU_09720
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: APL94764
UniProt: A0A1L5BPC9
LinkDB All DBs
Position
complement(2024479..2025291)
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTVAGLRSVLQGSLLTRVEPRRADLRFPIPVDLRQRLTGATVTGLSRRAKYG
LIDTDRGDTLIFHLGMSGRWRIDPAEIGAHDHLLIGTGGGRLLALNDPRRFGSLDLVRSE
AREAYNPFTRMGPEPLGPDFTPDSLTAALKGKATSIKAALLDQRIVAGLGNIYVCEALNM
AGIAPTREAGRVGRARLVLLVDAIREVLAAAIAAGGSTLRDYARPDGELGYFSKQWRVYG
REGEPCVCGTPIRRRVDGGRSTFFCPKCQK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacttcccgaagtcgaaaccaccgtggcgggcctgcgctccgtcctgcaaggc
tcgctcctgacgcgggtggagccgcggcgcgccgacctgcgcttcccgatacccgtcgac
ctgcgccagcggctgaccggcgccaccgtcaccggcctgtcgcgccgcgccaaatatggc
ctgatcgacaccgatcgcggcgacacgctgatcttccaccttggcatgtcgggccgctgg
cgaatcgatccggcggagatcggggcgcatgatcatctgctgatcgggacggggggaggg
cggctgcttgcgctgaacgacccgcgccgcttcggctcgctcgacctggttcgcagcgag
gcgcgggaagcctataatcccttcacccgcatgggaccggaaccgctggggccggatttc
acccccgatagcctgaccgccgcgctcaagggcaaggcgacgtcgatcaaggccgcgctg
ctcgaccagcgcatcgtcgcgggactgggcaatatctatgtctgcgaggcgctgaacatg
gcgggcatcgccccgacgcgcgaagcgggccgggtcggccgggcgcgtctcgtcctgctg
gtcgacgcgattcgggaggtgctggccgccgccatcgccgcgggcggctccaccctgcgc
gactatgcgcggcccgacggggaactgggctatttctccaagcaatggcgggtctatggc
cgcgaaggggagccctgcgtctgcggcacgcccatcaggcgccgcgtggacgggggcaga
tcgacctttttctgcccgaaatgccagaaatag

DBGET integrated database retrieval system