KEGG   Sphingobium indicum: SIDU_09810Help
Entry
SIDU_09810        CDS       T04604                                 

Definition
(GenBank) DNA glycosylase
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_09810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_09810
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     SIDU_09810
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_09810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-ProteinID: APL94781
UniProt: A0A1L5BPE3
LinkDB All DBs
Position
2044199..2044816
Genome map
AA seq 205 aa AA seqDB search
MVNTAEELRASLDVIAAMEPGFAAAIGRVGYPLPRMREPGYETLLRTIVGQQVSVAAAAA
VWRRLETELGAGCAPDALLSRDFDALRACGLSRQKQGYARSLAELVVSGGIDLHDLPQDD
EEAIAQLVRIKGIGRWSAEIYLLFAEGRPDVWPAGDLAVQIEIGRILGLPERPGEKLTRE
LAEPWRPHRGAAAIMAWHHYNTEVL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatacagcggaagagttgcgggccagcctggacgtcatcgccgccatggagccg
ggtttcgccgcggcgatcggccgggtcggctatcccctgccccgcatgcgcgaaccgggc
tatgaaaccctgctgcgcaccatcgtcggccagcaggtgagcgtcgccgcggccgccgcc
gtctggcgcaggctggagacggaactgggcgcgggctgcgcgccggacgccctgctctcc
cgcgatttcgacgcgctgcgcgcctgcggcctgtcgcggcagaagcagggctatgcccgc
agcctggcggaactggtggtgagcggcggcatcgacctgcacgacctgccccaggacgat
gaggaagccatcgcgcaactggtgcggatcaaggggatcgggcgctggtcggcggaaatc
tatctgctgttcgcggaagggcggccggatgtctggccggcgggagacctggcggtgcag
atcgagatcgggcggatattgggcctgcccgaacggcccggcgagaagctgacccgggaa
ctggccgaaccctggcgcccccatcgcggcgcggcggcgatcatggcctggcaccattat
aatacggaggtcttgtaa

DBGET integrated database retrieval system