KEGG   Sphingobium indicum: SIDU_13045Help
Entry
SIDU_13045        CDS       T04604                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
sinb03430  Mismatch repair
sinb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_13045
   03430 Mismatch repair
    SIDU_13045
   03440 Homologous recombination
    SIDU_13045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_13045
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SIDU_13045
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     SIDU_13045
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SIDU_13045
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SIDU_13045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1 RecJ_OB DHH
Motif
Other DBs
NCBI-ProteinID: APL95363
UniProt: A0A1L5BR56
LinkDB All DBs
Position
complement(2734074..2735840)
Genome map
AA seq 588 aa AA seqDB search
MTIALNVTRSILGQPWRWRGGSADGRDPGYRPDDLVTQLLLARGCPRDAVEAHRNPTIRH
FMPDPSLFRDMDAAAERLADAVARGEDVRIFGDYDVDGATSAALLIRLLRDLGLAARPYI
PDRLMEGYGPSGEALVRLAGEGATLIVTVDCGAQAFDALAQAKAAGVDVVVVDHHKCAAA
LPEALALVNPNRLDEGEEAAAHGHLAAVGVAFLLGAALIRALRKRNWFAQRTEPPLMDLL
DIVALGTVADVAQLKGLNRAFVAQGLKVMAKRRNIGLSALIDASRLTRAPLCHDLGFALG
PRINAGGRVGKADLGVRLLTTDDPAEAAQIAQELDLLNEERRTIEAAVQAEAEELLAAQG
NRAVALLSGAGWHPGVIGIVAGRIKEKAGRPAIVVAIDGDGTGKGSGRSISGVDLGAAVL
AAKDSGLLVAGGGHAMAAGLTVAADKVDALADFLDERLSGAVAKARDDRALLIDAVLAPA
GVNPDFVAAIDAGGPYGAGWPAPLIASGPMRVIKADVVGNGHLRAIMAGDDGRSIKTIAF
RQAESDLGQAILGAPRDRRLWIAGRAKIDDWGPRPAAELHLEDAAWAD
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgcgctcaacgtcacccgttcgatcctcggccagccctggcggtggcgcggg
ggcagcgcggacgggcgcgatccgggctatcggcctgacgatctggtgacgcaactgctg
ctggcgcggggctgcccccgcgacgcggtggaggcgcaccgcaatcccaccatccgccat
ttcatgcccgatcccagcctgttccgcgacatggacgccgccgccgaacggctggccgac
gcggtggcgcggggggaggatgtgcgcatcttcggcgactatgacgtggacggcgcgacc
agcgcggcgctgctgatccgtctgctgcgcgacctggggctggcggcccggccctatatc
cccgaccggctgatggagggctatggcccgtcgggcgaagcgctggtgcggctggcgggc
gagggcgcgaccctgatcgtcacggtcgattgcggcgcgcaggcgttcgacgcgctggcg
caggccaaggcggcgggcgtcgatgtggtggtggtcgaccatcataaatgcgccgccgct
ttgcccgaagcgctggcgctggtgaatcccaatcgcctggatgagggggaggaagccgcc
gcccacggtcatctggcggcggtgggcgtcgccttcctgctgggcgcggcgctgatccgg
gcgctgcgcaaacgcaactggttcgcgcaacggacggagccgccgctgatggacctgctc
gacatcgtcgcgctgggcaccgtggcggacgtggcccagttgaaggggctgaaccgcgcc
ttcgtggcgcaggggctgaaggtcatggcgaagcgccgcaatatcggcctttccgccctg
atcgacgccagccgcctgacgcgggcgccgctctgccacgacctgggcttcgcgctgggc
ccgcgcatcaatgcgggcgggcgcgtggggaaggcggacctgggcgtgcggctgctcacc
accgacgacccggcggaggccgcgcagatcgcgcaggaactcgacctgctgaacgaggaa
cgccggaccatcgaagcggccgtccaggcggaggcggaggaactgctggccgcgcagggc
aaccgggcggtggcgctgctgtccggcgcgggctggcatccgggcgtgatcggcatcgtc
gcggggcgcatcaaggagaaggcgggccgccccgccatcgtcgtcgccatcgatggggac
ggcaccggcaaggggtcgggccgctccatttccggcgtcgatctgggcgcggcggtgctg
gcggcgaaggatagcggcctgcttgtcgcgggcggcggccatgccatggcggcgggtctg
acggtcgcggcggacaaggtcgatgcgctggccgacttcctggacgagcggctttccggc
gccgtcgcgaaggcgcgggacgaccgcgccctgctgatcgacgcggtgctggcgcctgct
ggggtcaatccggatttcgtcgccgccatcgacgccggcggcccctatggcgcgggctgg
cccgcgccgctgatcgcttccgggccgatgcgggtcatcaaggcggacgtggtgggcaac
ggccatttgcgcgccatcatggcgggcgatgacggccggtcgatcaagaccatcgccttc
cgccaggcggaatccgacctgggccaggccatattgggggcgccccgcgaccggcggctg
tggatcgcgggccgggcgaagatcgacgattggggtccgcgccccgccgccgaactgcat
ctggaggacgccgcctgggccgattga

DBGET integrated database retrieval system