KEGG   Sphingobium indicum: SIDU_13505Help
Entry
SIDU_13505        CDS       T04604                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
sinb  Sphingobium indicum
Pathway
sinb03030  DNA replication
sinb03410  Base excision repair
sinb03420  Nucleotide excision repair
sinb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SIDU_13505
   03410 Base excision repair
    SIDU_13505
   03420 Nucleotide excision repair
    SIDU_13505
   03440 Homologous recombination
    SIDU_13505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sinb03032]
    SIDU_13505
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_13505
Enzymes [BR:sinb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SIDU_13505
DNA replication proteins [BR:sinb03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SIDU_13505
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     SIDU_13505
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SIDU_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc Ribosomal_60s HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: APL95448
UniProt: A0A1L5BRK2
LinkDB All DBs
Position
2829651..2832437
Genome map
AA seq 928 aa AA seqDB search
MAQNHLYLVDGSGYIFRAYHQLPPLTNRHGQPVGAVYGYTTMLWKLADELGKAEGPTHLA
VVLDKGSHTFRNDMYDAYKANRPPPPEDLVPQFPMIRDATRAFSLPCIEEAGFEADDIIA
SYTKAAVAQGWHVTIVSSDKDLMQLIQPGVDMYDTMKNERRGADYVMTKFGVRPEQLGDV
LALMGDSVDNVPGVPGIGPKTAAKLITEYGGLEAALEAAPHMKKSKMQENLIEHADMARL
SRRLVALHDGMDLPEPLDDLTLKGIPLEPLQAFLEHHGFKSLLARAGAPAAAVAVATAAA
AVTEATAPSAPVLEEEPPIDRSLYETVVTEEALDRWIAAAHAEGLVAVDTETDMLDCVSC
ALVGVSLAVGPNAACYIPVGHGGKDMFAEKPDQLPLPLVLAKLKPLLEDDSVLKIGQNLK
YDITVLRRHGIEIAPYDDTIVMSFDLDAGQSLAGHGMDEAARVHLNHVCISFKDVCGTGK
SQISFAEVPLDKATEYAAEDADVTLRLWRLFKSRIANEGATRVYELVDRPLVGVIAKMEH
EGIKVDREALSRLSAEFTAGIAALEEEIHALAGQPFAIGSTQQLGAILFDKMGYKGGRKG
KSGAYSTDVTILEQLKAQGAEIAGKVLDWRQLSKLKSTYTDALQAQINKDSGRVHTSYSL
SGAQTGRLSSTDPNLQNIPIRTEVGRQIRHAFVAEPGNVILAADYSQIELRLAAHMADVP
ALKEAFANGEDIHAATAQQLFGEVNRDTRGRAKTINFAILYGISRWGLAGRLEISADEAQ
DMISRYYERFPGISLYITDTIEKARSRGYTETLFGRKTWFPRIKAPVQHERQGAERAAIN
APIQGTSADIIKRAMARMGPALAAEGLHQVEMLLQVHDELVFELPEGDVEHAGAVIRRVM
EGAAEPIVKLSVPLGVEIGHGSSWGAAH
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaatcatctctatctcgtcgacggcagcggctatatcttccgcgcctatcac
cagcttccgccgctcaccaacaggcatgggcagccggtcggcgcggtctatggctatacc
accatgctctggaagctggccgacgaactgggcaaggcggaaggcccgacccatctggcg
gtggtgctggacaagggcagccacaccttccgcaacgacatgtacgacgcctacaaggcg
aaccgcccgccgccgccagaggatctggtcccgcagttcccgatgatccgcgacgcaacc
cgcgctttctccctcccctgcatcgaggaagcggggttcgaagcggacgacatcatcgcc
agctataccaaggccgccgtcgcgcagggctggcacgtcaccatcgtcagttccgacaag
gatctgatgcagctgatccagcccggcgtcgacatgtacgacacgatgaagaatgagcgg
cgcggcgcggattatgtgatgaccaagttcggcgtccggcccgaacaattgggcgacgtg
ctggcgctgatgggggacagcgtcgacaatgtccccggcgtccccggcatcggtcccaag
accgccgccaagctgatcaccgaatatggcgggctggaagcggcgctggaagccgcgccg
cacatgaagaagtcgaagatgcaggaaaacctgatcgaacatgccgacatggcccgcctg
tcgcgcaggctggtggcgctgcatgacggcatggacctgcccgaaccgctggacgacctg
accctgaagggcattccgctggagccattgcaggccttccttgagcatcatgggttcaag
tcgctgctcgcccgcgccggcgcgcccgccgccgccgtggcggtcgcgaccgcggcggcc
gccgtcaccgaagccaccgccccctccgccccggtgctggaggaagaaccgccgatcgac
cgcagcctctacgaaaccgtggtgacggaggaggcgctggaccgctggattgccgccgcc
catgccgaagggctggtcgccgtcgatacggagaccgacatgctggactgcgtgtcctgc
gcgctggtcggggtgagcctggccgtcgggccgaacgccgcctgctacatacccgtcggc
catggcggcaaggacatgttcgcggaaaagcccgaccagcttcccctcccgctggtcctc
gcgaaactcaagccgctgctggaggacgacagcgtcctcaagatcggccagaatctgaaa
tatgacatcacggtcctgcgccgccacgggatagagatcgccccctatgacgacaccatc
gtcatgagcttcgacctcgacgccgggcagagcctggcgggccacggcatggacgaggcg
gccagggtccacctcaaccatgtctgcatcagcttcaaggatgtgtgcggcaccggcaag
agccagatcagcttcgccgaagtcccgctcgacaaggcgaccgaatatgccgccgaggat
gcggacgtcacgctgcgcctgtggaggctgttcaagagccgcatcgccaatgagggcgcg
acccgcgtctacgaactggtcgaccggccgctcgtcggcgtgatcgcgaagatggagcat
gagggcatcaaggtcgaccgcgaggcgctctcccgcctctccgccgagttcaccgccgga
atcgcggcgctggaggaggaaatccacgcgctggccggccagcccttcgccatcggatcg
acgcagcaactgggcgcgatcctgttcgacaaaatgggttacaagggcggcaggaagggc
aagtccggcgcctattcgaccgacgtcaccatattggagcaattgaaggcccagggcgcg
gagatcgcgggcaaggtgctggactggcggcagctttccaagctcaaatcgacctatacc
gacgcgctccaggcccagatcaacaaggatagcggccgggtccataccagctacagcctg
tccggcgcgcagaccggccgcctgtcgtcgaccgaccccaatctccagaacatcccgatc
cgcaccgaagtgggccgccagatccgccacgccttcgtcgcggagccgggcaatgtcatc
ctggcggcggactatagccagatcgaactgcgcctggccgcgcacatggcggacgtgccc
gcgttgaaggaggcgttcgccaatggcgaggacattcacgccgccaccgcccagcaattg
ttcggggaggtcaaccgcgacacgcgaggccgggccaagacgatcaatttcgcgatcctc
tacggcatcagccgctggggcctggccggtcggctggagatcagcgccgacgaagcgcag
gacatgatcagccgctattatgagcgtttccccggcatcagcctctacatcaccgacacc
atcgaaaaggcgcgttcaaggggctatacggagacgctgttcgggcggaagacatggttc
ccgcgcatcaaggcgccggtccagcacgaacgccagggcgcggagcgcgccgcgatcaac
gccccgatccagggcaccagcgccgacatcatcaagcgcgccatggcccgcatgggaccg
gcgctggcggccgaagggctgcaccaggtcgagatgctgctgcaggtgcatgacgaactg
gtcttcgaactgccggagggcgatgtggagcatgccggcgcggtgatccggcgcgtcatg
gagggcgcggcggagccgatcgtgaagctgagcgtgccgctgggggtagagatcggccat
ggttcgagttggggggcggcgcattag

DBGET integrated database retrieval system