KEGG   Sphingobium indicum: SIDU_13670Help
Entry
SIDU_13670        CDS       T04604                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sinb  Sphingobium indicum
Pathway
sinb00620  Pyruvate metabolism
sinb00680  Methane metabolism
sinb01100  Metabolic pathways
sinb01120  Microbial metabolism in diverse environments
sinb01200  Carbon metabolism
Module
sinb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SIDU_13670
  09102 Energy metabolism
   00680 Methane metabolism
    SIDU_13670
Enzymes [BR:sinb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SIDU_13670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: APL95475
UniProt: A0A1L5BRF4
LinkDB All DBs
Position
complement(2863650..2866349)
Genome map
AA seq 899 aa AA seqDB search
MATLASSSVPAITQNPDIRYLGRLLGDVIRAYGGEKIYKQTEYIRSASVDRARGLHGADV
VDTGLDALSLDDTLSFVRGFMLFSMLANLAEDRQGVAAEPGADVASAVEKLDSHGIGRDA
VLDLLSHALIVPVLTAHPTEVRRKSMIDHKNRIADLMLLKDGGRTETDEGENLDEAIFRQ
IALLWQTRPLRREKLFVADEIENVLAYFRDVFLPVLPALYARWERVLGARPQSFLRVGNW
IGGDRDGNPFVQAPQLRLALAKGCEAALGFYMDALHALGAELSLSTELAHVPQAVLDLAD
ASGDVSPSRQDEPYRRAISGIYARLAATHRSLVGKAAPRTSALKGEPYASPADLRRDLVT
VAQGLASEGNGALATGGALGRLIRAVETFGFHLATLDMRQNSDVHQGVVAELLKVAGVEA
DYAGLDEYARIALLRRELANNRPLGTPFFEYSERTASELAIVHAAAEAHRIYGPQCITHY
IISKAESVSDLLEVNIILKEAGLWRAGADGGPPQAAIMAVPLFETIADLEAAPKIMAAYF
GLPEVGGVVRERGHQEVMIGYSDSNKDGGYITSTWGLFQASKALAPVFAEAGTAMQLFHG
RGGAVGRGGGSSFAAIQAQPKGTVQGRIRITEQGEVIAAKFGTRDVAMTNLEATTSATLL
ASLEPEVLSDRDAARFAAAMDQLSKTAFAAYRDLVYGTDGFKEFFRQLTPIQEISGLKIG
SRPASRTKSTRIEDLRAIPWVFSWAQARVMLPGWYGVGHALSAFEDKALLADMAQHWSFL
QSALANLEMVLAKSDLGIAAHYLPLVEDQARGAEIFDRIRGGWDMTHDGLLAATGQSRLL
ERNPKLDTSIRLRLPYIEPLNLLQVELMKRHRSGEDDPRIKEGIELSINAIATALRNSG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcttgcatcctcctccgtgccggcgatcacccagaatcccgacatccgctat
ctcggccggctgctgggcgacgtcatccgcgcctatggtggggagaagatctacaagcag
accgaatatatccgctccgcctcggtcgaccgggcgcgggggctgcacggcgcggacgtg
gtcgacaccggcctggatgcgctcagcctggacgacacgctcagcttcgtgcgcggcttc
atgctcttttccatgctcgccaacctggccgaggatcgtcagggcgtcgccgccgaaccg
ggcgccgacgtcgcctctgccgtggaaaagctcgactcccacggcatcggccgcgacgcc
gtgctcgacctcctctcccacgccctgatcgtcccggtcctcaccgcccacccgaccgag
gtgcggcgcaagagcatgatcgaccacaagaaccgcatcgccgacctgatgctgctcaag
gatggcggccgaacggaaaccgatgagggcgaaaatctggacgaagcgatcttccgccag
atcgcgctgctctggcagacccgtccgctgcgccgcgaaaagctgttcgtcgcggacgag
atcgaaaatgtcctcgcctatttccgcgatgtcttcctgcccgtcctgcccgccctctac
gcccgctgggaacgtgtcctcggcgcccgcccgcaaagcttcctgcgcgtcggcaactgg
atcggcggcgaccgcgacggcaatcccttcgtccaggcgccgcagctccgattggcgctc
gccaagggctgcgaggcggcgttgggcttttatatggatgcgctccacgccctgggcgcg
gaactgtcgctctcgaccgaactggcccatgtgccgcaggcggtgctggacctggccgac
gccagcggcgacgtctcccccagccgccaggacgaaccctatcgccgggcgatttccggc
atatacgcccgtctggccgcaacccacaggtcgctggtcggcaaggccgcgccccgcacc
tcggcgctcaagggggaaccctatgccagcccggccgacctgcggcgcgatctggtgacg
gtggcgcagggcctggcgagcgagggcaatggcgccctggcgacgggcggcgcgctcggc
cgcctgatccgcgcggtcgagaccttcggcttccatctcgccacgctcgacatgcggcag
aatagcgacgtccaccagggcgtggtggccgaactgctgaaagtcgcgggggtggaggcg
gactatgccggcctcgacgaatatgcccgcatcgccctgctgcggcgggaattggcgaac
aaccggccgctcggcacgccctttttcgaatattcggaaaggaccgcctccgaactcgcc
atcgtccatgccgcggcggaggcgcaccgcatctacggcccgcaatgcatcacccattat
atcatctccaaggcggaaagcgtttccgacctgctggaggtcaacatcatcctcaaggaa
gcgggcctgtggcgcgcgggcgcggacggcgggccgccgcaggccgcgatcatggccgtg
ccgttgttcgaaaccatcgccgacctggaggccgcgcccaagatcatggccgcctatttc
ggcctgccggaggtggggggcgtggtgcgggaacgcggccatcaggaagtgatgatcggc
tattccgacagcaacaaggacggcggctacatcacctccacctgggggctgttccaggcg
agcaaggcgctggccccggtctttgccgaagcgggcacggcgatgcagcttttccacggc
cgcggcggcgcggtcgggcgcggcggcggctcctccttcgcggcaatccaggcgcagccc
aagggcacggtgcagggccgcatccgcatcaccgaacagggcgaggtgatcgccgccaaa
ttcggcacccgcgacgtcgccatgaccaatttggaggcgacgaccagcgcgaccctgctc
gccagcctggaacccgaagtcctgtccgaccgcgacgccgcccgcttcgccgccgccatg
gaccaattgtcgaagaccgccttcgccgcctatcgcgacctggtctacggcaccgacggg
ttcaaggaattcttccggcaattgaccccgatccaggaaatttccggcctcaagatcggc
tcccgtccggccagccgcaccaagagcacccggatcgaggatctgcgcgccatcccctgg
gtgttcagttgggcgcaggcgcgggtgatgctgccgggctggtacggcgtgggtcacgcg
ctttccgccttcgaggacaaggcattgttggcggacatggcgcagcactggtccttcctg
caatccgcgctcgccaatctggagatggtgctggccaagtcggacctcggcatcgccgcc
cattatctgccgctggtggaggatcaggcgaggggcgcggagattttcgaccgcataaga
ggcggctgggacatgacccatgacggcttgctcgccgccaccggccagtcgcgcctgctg
gagaggaatccgaagctcgacacgtcgatccgcctgcgcctgccctatatcgagccgctg
aacctgctccaggtcgaactgatgaagcgccaccgcagcggcgaggacgacccgcgcatc
aaggaaggcatagaattgtcgatcaacgcgatcgcgacggcgctgaggaatagcggatag

DBGET integrated database retrieval system