KEGG   Sphingobium indicum: SIDU_15335Help
Entry
SIDU_15335        CDS       T04604                                 

Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_15335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_15335
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     SIDU_15335
DNA repair and recombination proteins [BR:sinb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_15335
 Prokaryotic type
     SIDU_15335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Motif
Other DBs
NCBI-ProteinID: APL95776
UniProt: A0A1L5BSD5
LinkDB All DBs
Position
3224320..3225390
Genome map
AA seq 356 aa AA seqDB search
MRVEGPSDKIASDLLAHYDVHARSLPWRAPPGANAADPYRVWLSEVMLQQTTVAAVGPYF
ATFTRRWPDVAALAAEEDAEVMAAWAGLGYYARARNLLACARAVAGQHGGAFPDTEEGLR
ALPGVGAYTAAAVAAIAFGRRAVVVDANVERVVARLFAISTPLPAARPEIRAATDAITPD
LRAGDFAQAMMDLGATICTARNPACGICPLRPHCAAFRTADPAAFPVKAAKKAKPRRLGH
GWWIERQDGHVWLVRRPGRGMLGGMRALPSSEWNDAPDATPPLPAPWRQVAEPVAHVFTH
FSLALTVHHAHVGQDATPPGEGEWWPVAEIGRAGLPTLFARAAEAAMKERRKDARF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgagggaccatccgataaaatagcatccgacctgctcgcccattatgacgtc
catgcgcgcagcctgccctggcgcgcgccgccgggggccaatgcggccgatccctatcgg
gtctggctgtcggaggtgatgctccagcagacgacggtggcggcggtcggcccttatttc
gcgacgttcacgcggcgctggcccgacgtggcggcgttggcggcggaggaggatgcggag
gtcatggccgcctgggcggggctgggctattatgcccgcgcccgcaacctgctggcctgc
gcgcgggcggtggcgggccagcatggcggcgcgtttcccgatacggaggagggcctgcgc
gccctgccgggcgtcggcgcctatacggcggcggcggtggcggcgatcgccttcgggcgg
cgggctgtggtggtcgacgccaatgtcgagcgggtggtggcgcggcttttcgccatatcg
acgcccctgcccgctgcgcggccggagattcgggcggcgaccgatgcgatcacgcccgat
ctgcgcgccggggacttcgcccaggcgatgatggacctgggcgccaccatctgcacggcg
cgcaatccggcctgcggcatttgcccgctgcggccgcattgcgcggctttccgcaccgcc
gatcccgccgccttccccgtcaaggcggcgaagaaggccaagccgcgccggctgggccat
ggctggtggatagagcggcaggacggccatgtctggctggtgcggcggcccggcaggggg
atgctgggcggcatgcgggcgctgccttcctccgaatggaacgacgcgcccgacgcgacg
ccgcccctgcccgccccctggcggcaggtcgcggagccggtcgcccatgtttttacccat
ttctccctcgcattgacggtgcatcatgcccatgtggggcaggatgcgacaccgcccggc
gagggtgaatggtggccggtggcggaaatcggaagggcgggcctgccgacgctgttcgcc
cgcgcggccgaagcggcgatgaaggagagaaggaaggatgcacggttctaa

DBGET integrated database retrieval system