KEGG   Sphingobium indicum: SIDU_15530Help
Entry
SIDU_15530        CDS       T04604                                 

Definition
(GenBank) hypothetical protein
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
sinb  Sphingobium indicum
Pathway
sinb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sinb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SIDU_15530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sinb03400]
    SIDU_15530
Enzymes [BR:sinb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     SIDU_15530
DNA repair and recombination proteins [BR:sinb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SIDU_15530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco
Motif
Other DBs
NCBI-ProteinID: APL95805
UniProt: A0A1L5BSD9
LinkDB All DBs
Position
3261507..3262070
Genome map
AA seq 187 aa AA seqDB search
MERVRCAWAGSDPLYCAYHDSEWGVPERDSRMLWETLMLEGFQAGLSWITILRKRETFRA
AFAGFDPDKVARFDGADVERLMGDPGIIRARAKIEATIGGARIFRDMRERGEDFSAYAWD
FVGGEPIRNDGLTFPARTDLSEAISKDLKKRGFKFVGPTIVYAWMQAVGMVNDHAVDCFR
RDEVGKA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggtccgttgcgcctgggctggatcggacccgctttattgcgcctatcatgac
agcgaatggggcgtgccggagcgggattcgcggatgctctgggaaacgctgatgctggag
ggctttcaggcggggctgagctggatcaccatattgcgcaagcgggagacgtttcgcgcc
gcctttgcggggttcgatccggacaaggttgcgcgcttcgacggggccgatgtcgaacgt
ttgatgggcgaccccggcatcatccgggcgcgggcgaaaatcgaagcgacgatcggaggc
gcgcggattttccgcgacatgcgggaacggggcgaggatttttccgcctatgcctgggat
ttcgtcgggggcgagccgatccggaacgacggcctgaccttccccgccaggaccgacctt
tcggaagcgatttccaaggacctcaagaagcgcggcttcaaattcgtgggacccaccatc
gtctatgcatggatgcaggccgtcgggatggtgaacgatcatgcggtggattgcttccgg
cgggatgaggtcggcaaggcgtga

DBGET integrated database retrieval system