KEGG   Sesamum indicum (sesame): 105155701Help
Entry
105155701         CDS       T04135                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00630  Glyoxylate and dicarboxylate metabolism
sind00710  Carbon fixation in photosynthetic organisms
sind01100  Metabolic pathways
sind01200  Carbon metabolism
Module
sind_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sind_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sind_M00532  Photorespiration
sind_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105155701
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105155701
Enzymes [BR:sind01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     105155701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 105155701
NCBI-ProteinID: XP_011069924
LinkDB All DBs
Position
LG2
AA seq 121 aa AA seqDB search
MKTWNPINNKKFETLSYIPPLSEQSIAKEIEYMIKKGWVPCIEFDEVGYVYRENSRMPNY
YDGRYWTLWKLPMFGCTDSSQVLKEIQECRQAYPNAYIRCLAFDNVKQAQCMAFLIQNPN
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatggaacccgataaataacaagaaattcgagaccctgtcctacattccacca
ctgtcggaacagtcgatcgccaaggagatcgagtacatgatcaagaagggatgggtacct
tgtatcgaattcgacgaggtgggatatgtgtacagggagaacagcaggatgccaaattac
tatgacgggagatactggacactgtggaagctgccaatgtttggttgcacagactcctcg
caggtgctgaaagaaattcaagagtgcagacaggcataccctaatgcttacatccgctgt
ttggcatttgacaacgtaaaacaggcgcagtgcatggcctttctcatccaaaaccccaac
aactga

DBGET integrated database retrieval system