KEGG   Sesamum indicum (sesame): 105156639Help
Entry
105156639         CDS       T04135                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00220  Arginine biosynthesis
sind00250  Alanine, aspartate and glutamate metabolism
sind00260  Glycine, serine and threonine metabolism
sind00630  Glyoxylate and dicarboxylate metabolism
sind00710  Carbon fixation in photosynthetic organisms
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
sind01200  Carbon metabolism
sind01210  2-Oxocarboxylic acid metabolism
sind01230  Biosynthesis of amino acids
Module
sind_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sind_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105156639
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105156639
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105156639
   00260 Glycine, serine and threonine metabolism
    105156639
   00220 Arginine biosynthesis
    105156639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sind01007]
    105156639
Enzymes [BR:sind01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     105156639
    2.6.1.4  glycine transaminase
     105156639
    2.6.1.44  alanine---glyoxylate transaminase
     105156639
Amino acid related enzymes [BR:sind01007]
 Aminotransferase (transaminase)
  Class I
   105156639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 105156639
NCBI-ProteinID: XP_020554617
LinkDB All DBs
Position
LG2
AA seq 481 aa AA seqDB search
MSSKSLDYENLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLMDDPNVGTLFHADAIARAKHYLSMTSGGLGAYSDSRGLPGIRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNSIIRGAHDGILVPVPQYPLYSATISLLGGSLV
PYYLEETANWGLDIGNLRQSVTQARSQGITVRAMVIINPGNPTGQCLSEANLKEVLKFCY
ENNLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNISPQTVEEIYKVASISLSPNVPGQIFMGLMVSPPKPGDISYERYVRESKGIL
ESLRRRARIMTDGFNCCRNVVCNFTEGAMYSFPQIRLPLKVMEAAKRAGKVADVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDNGGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaaatcattagattatgagaacttgaatgaaaatgtcaagaaatgtcagtat
gctgtccgaggagagctatatcttcgagcttctgagcttcagaaagaagggaagaagatt
atcttcactaatgttgggaatcctcatgctctgggacagaaacctctgacctttcctcgc
caggtggttgctctctgccaagctccattcctgatggatgatcctaatgtcggaacttta
tttcatgctgatgcaattgcaagagctaaacattatctttctatgacttcagggggtcta
ggtgcttacagtgattcacgtggccttcccggaattcggaaagaagttgcagagttcatt
gagagacgtgatggatatccaagcgatccggaactcatttttctaacagatggtgccagc
aaaggtgtgatgcagatcttaaacagtatcatacgtggtgcccatgatgggatattggtc
cctgttccacaatatccactttactcagccactatatctttacttggtggctctttagtg
ccttattatcttgaagagactgcaaattggggtcttgatatcggtaaccttcgtcaatca
gttactcaggctcgttctcaaggaataacggtacgagccatggtgataataaaccctgga
aaccctactggccagtgtcttagtgaagcaaatcttaaagaagtactgaaattttgctat
gaaaacaatctggttttgcttggtgatgaagtttatcagcaaaatatttaccaagacgag
cgccccttcataagtgcaaggaaggttctgatggacatggggccacccataagcaaggag
gtccagcttgtctcattccacactgtctcaaaaggttattggggagaatgtgggcaacgc
ggtggatactttgagatgaccaatatttctccacagacagtggaggaaatatacaaggtt
gcttccatctccctgagtccaaatgttcctggacaaatatttatgggacttatggtcagc
cctcccaaacccggagatatatcatatgagagatatgttagagaaagcaaaggaatccta
gagtcattgaggcggagagcgcgaataatgacggatggatttaactgctgcagaaatgtg
gtttgcaatttcactgaaggtgctatgtattctttccctcaaatacgcctacctctaaaa
gtaatggaggctgcaaaaagggctggaaaagtagctgatgttttctactgtcttaagctg
ctagaggccaccggaatttccaccgtcccaggttcaggctttggtcagaaagaaggggtg
ttccatctgagaaccaccatcttaccagctgaggaagatatgcctgccattatggccagt
ttcaagaaattcaacgacgaattcatggagcaatatgaagacaacgggggctattcaagg
atgtaa

DBGET integrated database retrieval system