KEGG   Sesamum indicum (sesame): 105157254Help
Entry
105157254         CDS       T04135                                 

Definition
(RefSeq) kinetochore protein Spc25
  KO
K11550  kinetochore protein Spc25, animal type
Organism
sind  Sesamum indicum (sesame)
Brite
Chromosome and associated proteins [BR:sind03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      105157254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spindle_Spc25 Anth_synt_I_N Tospo_nucleocap TMF_TATA_bd IncA
Motif
Other DBs
NCBI-GeneID: 105157254
NCBI-ProteinID: XP_011071921
LinkDB All DBs
Position
LG3
AA seq 313 aa AA seqDB search
MQGSGKSNMRTRMAEMRLVCEREIPIQQHRIDSLHTLYSNRFDFAKSEAQRTIQLQEKLG
KLKGELREAEDALVKALAVKTRKEAKRMAIEESISVMKARVEELKGIVEDQRGRKNEYAA
IISQQSEALTACKDKCNQNKEHREQIEEAISWYNKVLGFRIECGHGVKFIFSSINPKNPN
EEYSFIIRHENEKYTLLNCDPHLSDTKELVYELNKTNGLFKFVRTMREKFQEAVARGITL
HGSSLDQDSSIVSLSAPVASVSSDHRYESPLKEKGLQFSESNSKSRKVGKGHIVHSPGSA
SSLRRSSRLKGKN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagggttcagggaagagcaatatgaggacgcggatggcggaaatgcggttagtatgc
gagcgagaaattcccattcagcagcacagaattgactctttgcatactttatattcgaat
cgtttcgactttgcaaagtccgaagcccagcgtaccattcagcttcaagagaaattggga
aagcttaaaggggaattaagagaagctgaggatgctttagtgaaggctcttgctgtcaaa
actcgaaaagaggcaaagaggatggcgatagaggagtctatatctgttatgaaagctaga
gttgaagagttaaaaggaattgtggaagatcaaaggggaagaaaaaatgagtatgctgct
ataatatctcaacaatctgaagcattgactgcttgtaaagacaagtgtaatcagaacaaa
gaacacagggagcaaatagaagaggctatttcatggtataacaaggtccttggtttccgc
attgaatgtggtcatggtgtaaagttcatattctctagcattaatccaaagaacccaaat
gaggagtactcatttatcattcgccatgagaatgagaaatacacgttgcttaactgcgat
ccacatttgagtgacacaaaagagctggtttatgagttaaataaaaccaatggactgttc
aaatttgtcagaaccatgagagagaagtttcaagaagctgtggcacgtggaattactctg
catggatcgtctcttgatcaagactcttcaatagtttccctttctgctccagtagcttca
gtttcaagtgatcacagatacgaatctccgctcaaggaaaagggacttcaattttctgaa
tctaacagcaagtcaagaaaagttggcaaaggacacatagttcactcgcccggatctgcc
tcttctcttcgccgttcctcacgtttgaagggtaagaattga

DBGET integrated database retrieval system