KEGG   Sesamum indicum (sesame): 105157758Help
Entry
105157758         CDS       T04135                                 

Definition
(RefSeq) beta-galactosidase 17 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00052  Galactose metabolism
sind00511  Other glycan degradation
sind00531  Glycosaminoglycan degradation
sind00600  Sphingolipid metabolism
sind00604  Glycosphingolipid biosynthesis - ganglio series
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105157758
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    105157758
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    105157758
   00604 Glycosphingolipid biosynthesis - ganglio series
    105157758
   00511 Other glycan degradation
    105157758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sind04147]
    105157758
Enzymes [BR:sind01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     105157758
Exosome [BR:sind04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105157758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 105157758
NCBI-ProteinID: XP_011072527
LinkDB All DBs
Position
LG3
AA seq 692 aa AA seqDB search
MAKTGSLRRNTAKVVIFLITLFVLGAFAPLPSVSQRSSQFHLDKADERKFEIAGDMFWKD
GEPFRIIGGDLHYFRVHPEYWEDRLLRAKALGLNTIQTYVPWNLHEPRQGHRVFEGIADI
ISFLKLCKKLDLLVMLRAGPYICGEWDLGGFPAWLLAEEPAIRLRSSDPAFLDLVEKWWG
ILLPKISPLLYSNGGPIIMVQIENEFGSYGDDKAYLHYLVKLARGHLGDDILLYTTDGGA
RETLGKGTIPGDAVFSAVDFTTGDDPWPIFKLQKEFNAPGKSPPLSAEFYTGWLTHWGEK
IASTDATFTATYLEKILSMNGSAVLYMAHGGTNFGFYSGANTGSNEADYKPDLTSYDYDA
PIRESGDVDNAKYKALRRVIAKHSTEPLASIPPDNEKMGYGHIEIDKVSFLYDMIDMKDL
VDVVESENPISMEAIGQMFGFVLYASEYNPKGNGSVLSIPKVHDRAQVFISCTEDSAKRP
TYVDVITRWSNRPINLPYLKCESKNKLFILVENMGRLNYGPYMFDRKGILSSVYLDSRPL
YKWKMLPIPLQNLNEATQINPIILNAQKGLPKRSAQKKLKDKKNSVLEPAFYTGHFSVDK
VRDTYISFRGWSKGIAYVNEINIGRFWPSIGPQCNLYVPAPMLRQGENTLVILELESPNT
DLFVSSVDHPDFTCGPTRSALRKSREHRLLSS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactggaagcctgagaagaaatactgctaaagtagtcattttcttgataaca
ctcttcgtcttgggtgcttttgctcctctgccttcagtttcacagcgttcttcccagttc
catttagataaagcagatgaacggaagtttgagatagcgggggacatgttctggaaagat
ggggagccatttaggataattggaggtgacttgcattatttccgggtgcatcctgagtac
tgggaagatagactgctgagggcaaaggcattgggcttgaacaccattcaaacttatgtt
ccgtggaatttgcatgagccaagacaagggcatcgcgtatttgagggtattgcagatata
atatcatttctcaagctctgcaagaaactggatttgttggttatgctgcgtgctgggcct
tatatttgtggagaatgggatttgggtggcttccctgcatggttgcttgctgaagaacct
gctatcagactaagatcatcagatcctgccttccttgacttggttgaaaaatggtggggc
atcctacttccgaagatatctcctcttctttacagcaatggaggtcctattataatggtc
cagattgagaatgagtttggttcatacggggatgacaaagcttacctgcattacttggtc
aaactagcacgagggcatttgggagatgatatattattgtatactactgatggaggtgct
agggaaactcttgggaaaggaacaattccaggagatgctgttttctcagccgttgacttc
acaactggagatgacccatggcccatattcaagttgcagaaagagtttaatgcgccagga
aaatcacctcctctttcagccgagttctatactggttggcttacacattggggggagaaa
attgctagtactgatgccacttttacagctacttacttggaaaagattttgtcaatgaat
gggtccgccgtcctctacatggcacatggtggtacaaactttggattttatagtggtgct
aacactggatcaaatgaggctgactacaagcctgatcttacatcctatgattatgatgca
cctattagagaatctggcgatgtggacaatgcgaagtacaaagctctgagaagggtcatt
gccaaacatagcacagagcctcttgcttccattcctcccgataatgaaaagatgggttat
ggacatattgagatagataaagtttcatttttgtatgacatgattgacatgaaagacctt
gttgacgtggttgagtctgagaacccaatctcgatggaagctattggacagatgtttggc
ttcgttttatatgcctctgaatacaatccgaaaggcaatggtagtgtgttgtccatacca
aaggtgcacgatagagctcaagtgtttatatcctgtactgaagatagtgcaaaaaggcca
acatatgttgacgtcatcacgagatggtctaatagaccaattaatctgccttatttgaaa
tgtgaatccaaaaataaactatttattttggttgaaaacatgggtcgcttgaattatggg
ccgtatatgtttgacaggaagggtattttgtcttctgtttatcttgattcaaggcccctg
tataagtggaagatgcttccgattcctcttcaaaatctcaacgaggccacacaaatcaac
cccatcattcttaatgcacaaaagggacttcctaaacgatctgcccagaaaaagttaaaa
gacaaaaaaaactctgttttggaaccagctttttatactggtcacttcagtgtagacaaa
gtcagggacacatacatttcattcagaggctggagtaaaggaattgcatatgtaaatgag
ataaatattggacgtttttggccgtctattggaccgcagtgtaacctttatgttcctgct
ccaatgcttcgacaaggagagaatactctggttatcctggagctggaatcaccaaacact
gatctctttgtgagctcagttgaccatccagatttcacttgcggtcctacacgttcagca
cttaggaaatccagagaacatcgtttactatcttcatga

DBGET integrated database retrieval system