KEGG   Sesamum indicum (sesame): 105160529Help
Entry
105160529         CDS       T04135                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00040  Pentose and glucuronate interconversions
sind00051  Fructose and mannose metabolism
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105160529
   00051 Fructose and mannose metabolism
    105160529
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105160529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 UDPG_MGDP_dh_N Sacchrp_dh_NADP AlaDh_PNT_C NCD3G Methyltransf_25 MTS
Motif
Other DBs
NCBI-GeneID: 105160529
NCBI-ProteinID: XP_011076249
LinkDB All DBs
Position
LG4
AA seq 367 aa AA seqDB search
MGKGGMSHGNVGEGKDGEEENMAAWLLGVNNLKILPFKLPTLGPHDARIRMKAVGICGSD
VHYLKEMKLADFVVTEPMVIGHECAGVVEEVGSEVKHLAPGDRVAIEPGISCWRCALCKE
GRYNLCPEMKFFATPPVHGSLANQIVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRA
NVGPETNVLVMGAGPIGLVTMLSARAFGSPRVVIVDVDDHRLSVAKELGADETIKVSTNI
NDVSAEVEQIKKAMGAGIDITFDCAGFTKTMSTALGATLSGGKVCLVGLGHTEMTVPLAP
AAVREVDVVGVFRYKNTWPLCIEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSARGGNA
IKVMFNL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggtgggatgtcccatggaaacgttggagaggggaaagatggagaagaagag
aacatggcagcttggcttcttggggttaacaatctcaagattctgccttttaagcttcct
actcttggccctcatgatgctagaatccggatgaaggctgtgggtatatgtgggagtgat
gttcactacctcaaggagatgaaattggcagattttgttgtcacagaaccgatggtgatt
gggcatgagtgtgctggtgtcgttgaggaagttgggagtgaagtgaagcatctagcgcct
ggtgaccgcgttgccattgaacctggaataagttgttggagatgtgctctttgcaaggaa
ggcagatataacctttgcccggagatgaagtttttcgctactccccctgttcatggttcc
cttgcaaaccagattgtgcatccagcagacttatgtttcaaactccccgacaacgtgagt
ttagaggagggggcaatgtgtgagcccttaagtgttggggtccatgcgtgtcgccgtgcc
aatgttggtcccgagacaaatgttttggtgatgggagcgggacctataggacttgtaaca
atgctttcagctcgagcttttggatctccaagagttgtgattgtcgatgtagatgaccac
cgtctatcagttgctaaggagcttggagcagatgagaccatcaaagtttcgactaatatt
aatgatgtatctgcagaagtcgaacaaattaagaaagctatgggggctggaattgacata
acttttgactgtgcgggctttactaaaacgatgtcaacagctctaggtgccactttgtca
ggtggaaaagtttgccttgtcgggctgggtcacactgaaatgacagtcccccttgcccct
gctgctgtaagagaggtcgatgtggtaggcgtattccgatacaagaacacatggcctttg
tgcatcgagtttctgaggagtggaaagatagacgttaagccgttgatcacccacaggttc
ggattctctcagaaggaggttgaagaagcttttgaaaccagtgcacgtggtggtaacgct
atcaaggtcatgtttaatctgtag

DBGET integrated database retrieval system