KEGG   Sesamum indicum (sesame): 105161131Help
Entry
105161131         CDS       T04135                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00010  Glycolysis / Gluconeogenesis
sind00020  Citrate cycle (TCA cycle)
sind00620  Pyruvate metabolism
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
sind01200  Carbon metabolism
Module
sind_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105161131
   00020 Citrate cycle (TCA cycle)
    105161131
   00620 Pyruvate metabolism
    105161131
Enzymes [BR:sind01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     105161131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 105161131
NCBI-ProteinID: XP_011077029
LinkDB All DBs
Position
LG1
AA seq 469 aa AA seqDB search
MASLSFSSSVSSSTPFLRPSAFFLKPRSISRLPLVRAKIREIFMPALSSTMTEGKIVSWV
KSEGDVLSKGEPVVVVESDKADMDVETFYDGILAAIVVNDGETAPVGAPIGLLAETEDEI
AEAKAKAAAQSSSAPSATATKVEESAPVATKVEAPAPAVAAAAPATPGKVVATPYAKKLA
KQHKVDINKLVGTGPFGRITPEDVEKAAGITPAPKANVIAPVAPAASAATSTASPAKAAT
SFPEIPGSNVVPFTTMQAAVSKNMVESLSVPTFRVGYPISTDALDALYEKVKPKGVTMTA
LLAKAAAMALVQHPVVNATCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLL
SQKWKELVEKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTV
VADKDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENPESLTM
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctctccttctcctcctccgtttcctcctccacccctttcctccgtccttct
gccttctttctaaaaccccgctccatctctcgcctcccccttgtccgcgccaagatccgc
gagatctttatgcccgccctcagctctaccatgacggagggcaagatcgtcagctgggtt
aaatccgaaggcgacgttctctccaagggcgaacccgttgtcgtcgttgaatccgataaa
gccgatatggatgtcgaaactttttacgacggaatattagctgccattgtagttaatgac
ggcgaaacggctcccgttggcgccccgattgggcttttagccgagacggaggacgaaatc
gccgaagctaaggctaaagcagcggcgcaatcgtcgtctgcgcctagtgccacagccacg
aaagtggaagagtctgctcctgtcgctacgaaagtcgaagctcctgctcccgccgttgca
gcagctgctccggcgacaccggggaaggtggtggcaacgccgtatgcgaagaaattggcc
aagcagcataaggtggatattaataaattggtggggacagggccatttggcaggataacg
cctgaggatgtggagaaggcagctggaattacgcctgcccccaaggcaaatgtgatagcg
cctgttgccccagctgcatctgctgcaacgtctacggcatctccagcaaaggctgcaaca
agttttcctgagattccagggtcaaatgtcgtacccttcaccacgatgcaggctgctgtg
tcaaagaatatggtggagagtcttagcgtgccgactttcagagttggttaccccatctcg
acagatgcgcttgatgccctatacgagaaggtgaagccaaagggtgttaccatgactgct
ttgttggccaaagcagcagcaatggcattggttcagcatccagtggtgaatgctacatgt
aaagatgggaaaagttttacctataatagcagcataaatattgctgtcgctgtggctatt
aatggtggattgatcacacctgttcttcaagatgctgataagttggatctctatctgttg
tctcaaaaatggaaggagctagttgagaaggctagggcaaagcaacttcagccccaggag
tacaattcagggactttcacgttatctaatttgggaatgtttggagtggatagatttgat
gctattcttccaccaggacagggggctattatggctgtgggagcatcaaaacctactgtt
gtagctgacaaagatggattcttcagcgtcaagaacaagatgctggtgaacgttacagct
gatcaccgaatcatctatggggctgacttggctgcattccttcaaaccttctcaaaaatc
attgagaacccagaaagcttgacgatgtag

DBGET integrated database retrieval system