KEGG   Sesamum indicum (sesame): 105166035Help
Entry
105166035         CDS       T04135                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00010  Glycolysis / Gluconeogenesis
sind00051  Fructose and mannose metabolism
sind00052  Galactose metabolism
sind00500  Starch and sucrose metabolism
sind00520  Amino sugar and nucleotide sugar metabolism
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
sind01200  Carbon metabolism
Module
sind_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sind_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105166035
   00051 Fructose and mannose metabolism
    105166035
   00052 Galactose metabolism
    105166035
   00500 Starch and sucrose metabolism
    105166035
   00520 Amino sugar and nucleotide sugar metabolism
    105166035
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105166035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sind04131]
    105166035
Enzymes [BR:sind01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105166035
Membrane trafficking [BR:sind04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105166035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 105166035
NCBI-ProteinID: XP_011083536
LinkDB All DBs
Position
LG7
AA seq 494 aa AA seqDB search
MSVAVTPPALRSFHSGRSAGWPPRPRVVMSVRSSNTVSAAPILIKLQRDCATPLPVLRHV
ADAMAADMRAGLEVDGGSDLKMILSYVDALPTGNEKGLFYALDLGGTNFRVLRVQLGGKD
ERVVETEFEQVSIPQELMFGTSEELFDFIASGLEKFAQKEAGNFCLPKGRTRELGFTFSF
PVKQTSIDSGILIKWTKGFAVSGTAGKDVVACLNEAMKRQGLNMRVSALVNDTVGTLAGA
RYWDDDVMVAVILGTGTNACYVERIDAIPKLHGPNSKSGRTIVNTEWGAFSNGLPLTEFD
IEMDAESINPGEQIFEKTISGMYLGEIVRRVLLKMAEDARLFGDCDPEKLRMPFSLRTPD
ICAMQQDSSKDFEVVGSILHDVTGVSSDLIARKIVVDVCDTIAKRGGRLAGAGIVGILQK
MEDDSRGLVFGKRTVVAMDGGLYEHYPQYRSYLQDAVTELLGPEISKNIVIEHSKDGSGI
GAALLAATNSMYQH
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgccgtcaccccaccagccctccgatcattccactccggccgatcagctgga
tggccgccgcggcctagagttgtgatgagcgtccgatcatccaacacggtctcagcagct
ccgattctcattaagttgcagagggactgcgccacacctttgcccgttttgcgccacgtc
gcggatgccatggccgctgacatgcgggctgggctggaggtggatggtggcagtgatctc
aagatgattcttagctacgttgatgcactgccgacggggaatgaaaagggattattctat
gctttggatcttggtggtacaaatttccgagtgctgagagtgcagttaggaggaaaggat
gaacgtgtggtcgagacagaatttgagcaagtttctatccctcaggaattaatgtttggg
acctctgaggagctcttcgatttcattgcttctgggctggaaaaatttgctcaaaaagaa
gccggaaatttttgtctacccaagggaaggacgagggagttaggatttactttttctttt
ccagtgaagcagacatcaattgactcaggcatcctcatcaagtggactaagggatttgca
gtctctggaactgcaggaaaagacgtagttgcttgcttgaatgaagctatgaagaggcag
gggctaaacatgcgggtgtctgccctggtcaatgatactgtcggaacattagctggtgct
agatactgggacgatgatgtgatggttgctgtcattctaggaactggaaccaatgcttgc
tatgtggaacgcatcgatgccatccctaagctgcacggcccaaattcaaaatctggaaga
acgattgtaaacaccgagtggggagcattctcaaatggccttcccttgactgagtttgac
atagaaatggatgctgagagtattaaccccggcgaacagatatttgagaaaacaatatct
ggcatgtatctcggtgaaattgtgagaagagtgttgctcaaaatggctgaagatgctaga
ttatttggtgactgtgatccagaaaagcttcgaatgccgttttctctcagaacaccagat
atatgtgccatgcagcaagactcttccaaggattttgaagtagttgggtcaatcctccac
gatgtcactggggtgagttccgatttgatcgcaaggaagattgtagtggacgtttgtgat
acaatagcaaaacgcggcgggcggctggcaggcgcaggaatagttgggattctccaaaag
atggaggacgactcaagaggccttgtttttggtaagaggacggtggtggccatggatggc
ggcttgtacgagcattacccacagtacaggagttacctccaagatgccgtcacagagctt
ctgggaccggagatatcgaagaatatagttatagaacactcaaaggatggctctggcatt
ggagctgctctcttggctgctacaaactctatgtatcaacattga

DBGET integrated database retrieval system