KEGG   Sesamum indicum (sesame): 105167244Help
Entry
105167244         CDS       T04135                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00052  Galactose metabolism
sind00500  Starch and sucrose metabolism
sind01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105167244
   00500 Starch and sucrose metabolism
    105167244
Enzymes [BR:sind01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105167244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105167244
NCBI-ProteinID: XP_011085177
LinkDB All DBs
Position
LG8
AA seq 896 aa AA seqDB search
MVTSRWPSPSLYHPHLLPILFICFSLPLFLARDEGLPIGHGYGYTLKSISKISSPSSLTA
TLQLIKSSSILGPDIHNLNLTASYVTDDCLRVRITDSDNPRWEVPHDIIPRQTPLHHNLL
VSNGIEDHHFLSTPNSDLVFTLHNTTPFGFTISRSSDGDILFDTSPVPGVPDTFLLFKDQ
YLQISSSLPPTRSNLYGLGEHTKSSFNLKHNQTLTLWNADTGSDNLDLNLYGSHPFYMDV
RSPVGTAHGVLLLNSNGMDIVYTGERITYKVIGGVLDFFLFAGPSPKMVMDQYTQLIGRP
APMPYWSFGFHQCRWGYENVNVVEQVVSRYAEAGIPLEVIWTDIDYMDGFKDFTLDPINF
PLEKMKSFVDLIHQNGQKYVLILDPGISVNQTYQTYIRGMQANIFIQRDNISYQGVVWPG
NVYYPDFLNPAGETFWSNEISIFHNLLPFDGLWLDMNEISNFITSSPSAGSTLDDPPYKI
NNSGAQISISSRTVPATSLHFGNITEYNAHNLYGLLESKVTNQALLKLTGKRPFILSRST
FVGSGKFTAHWTGDNAATWDDLAYSIPSILSFGLFGIPMVGADICGYSGNTTEELCRRWI
QLGAFYPFSRDHSAKDTIRQELYLWDSVASAAKKALGLRYQLLPYLYMLMYEAHMRGTPI
ARPLFFSFPQDTNTYEINSQFLLGKGVLVSPVLKQGAVSVDAYFPMGNWFSLFDYSNSLS
VKNGKYVTLDAPSDHINVHVREGNILAMQGQASTTQAARKTPFKLLVVLSSNENSTGEVF
LDDGDEIEMGKEGGRWSLVQYNGNISGSTVRLESKVVNGEYAVSKEWMIENATILGLSNS
VGLKSFEVLIKSGGNWMKSTMGRSSLKRSGQFGIVELSNMSIPIGKEFKLKLNLCM
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggtaacaagccgatggccctctccctctctgtatcatccccatcttctccccattctt
ttcatctgtttttcacttcccctcttcttagctcgcgatgagggcctgccaattggacat
ggatatggatatacccttaaatctatttccaagatttccagcccatcttcactcactgcc
actcttcagcttatcaaaagttcctccattcttggtccagacattcataatctcaacctc
acagccagttatgtaactgatgattgtctcagagtccgaattacagactctgataacccg
agatgggaagtcccacacgatatcatcccccgccaaaccccactccaccataatctcctt
gtctcaaatggaattgaagaccaccatttcctctcaactcccaactcagacctcgtcttc
accctccataacaccaccccctttggcttcaccatctcaaggtcttcagacggtgacata
ctttttgacacctcaccggttccaggcgttcccgacacttttcttttgttcaaagatcaa
tacctccaaatctcatcttcactcccaccaaccaggtccaacctttacggccttggtgag
cacacaaagagttctttcaacctcaaacacaaccaaacacttactctctggaatgctgac
actggaagtgacaatcttgatctcaacttatacggatcccaccctttctacatggacgtc
cgcagccccgtgggaactgctcatggggtattgttgctcaatagtaatggcatggacata
gtctacactggtgaaagaattacttacaaggtgataggtggtgttcttgatttctttcta
tttgctggaccgtctcccaaaatggtcatggatcaatacacacagcttattggtcgtcct
gctccaatgccatactggtcttttggatttcatcagtgccgatggggttatgaaaatgta
aatgttgttgagcaagtggtcagccggtatgccgaagctgggattccactcgaggttatt
tggacggatattgactacatggatggtttcaaggattttacacttgaccccattaatttc
ccattggagaagatgaagagttttgtcgacttgattcaccaaaatggtcagaagtacgtt
ctcatccttgatcctggcattagtgtgaaccagacatatcagacatacataaggggaatg
caagcaaacatatttatacaacgagataatatctcataccagggggtcgtttggcctggg
aatgtctactaccctgattttctaaatcctgcaggcgaaaccttttggagcaatgagatc
agtatcttccacaatcttctcccgtttgacggcctatggcttgacatgaatgagatatct
aattttataacctcatctcctagtgcaggctccacactcgatgaccctccttataaaata
aacaactcaggagctcaaatttcgatcagtagtagaactgttcctgctacttctctgcat
tttggcaatatcacagaatataatgctcataacctctatgggctattagagtccaaagtc
acgaatcaggcattactcaaactgactggtaaaagaccatttatactgtcccgatcaact
tttgtgggatctggaaaattcacagcacattggactggagataatgcagccacatgggat
gacttggcatactcgattccaagcatcttgagttttggactgtttggcatccctatggtt
ggagcagatatatgtggctattctggaaatactactgaagagctttgtcgacgttggata
cagctaggggccttttatccattctcaagggaccattctgcaaaagacaccatccgtcaa
gaactctatctctgggattctgtggcctcagcggccaagaaggcacttggcctccggtat
cagttacttccatacttgtacatgctaatgtacgaggcacatatgagagggacccccatt
gctcggcctcttttcttctcattccctcaagacacaaacacttacgaaatcaactctcaa
tttcttcttggtaaaggggtactggtctcacctgtgttgaagcaaggggccgtctcagtt
gatgcatactttccaatggggaattggttcagcctctttgactactcaaactccttgagt
gtgaaaaatggaaaatacgtaacacttgatgcaccatccgatcatataaacgtccatgtc
cgagaagggaacatactagcaatgcaaggacaagcttcgactacacaggctgctcgaaag
acaccgtttaagcttttggtggttctgagcagcaatgagaacagcacgggggaagtgttt
ctggatgacggagatgaaattgagatgggaaaagaaggaggaaggtggagtttggtacag
tataatggcaatatatctggaagcacagtgaggttggaatcaaaagttgttaatggagag
tatgctgtgagtaaggaatggatgatagaaaacgcaaccattttgggattgagcaacagt
gtggggttaaagagctttgaggttctaataaagagtggaggcaattggatgaagagcact
atgggaagaagtagtttaaagaggagtggacagtttggtatagttgagttgtccaatatg
tcaattcctattgggaaagagttcaagttgaagctcaacttgtgcatgtag

DBGET integrated database retrieval system