KEGG   Sesamum indicum (sesame): 105167783Help
Entry
105167783         CDS       T04135                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00250  Alanine, aspartate and glutamate metabolism
sind00410  beta-Alanine metabolism
sind00430  Taurine and hypotaurine metabolism
sind00650  Butanoate metabolism
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Module
sind_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105167783
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105167783
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105167783
   00430 Taurine and hypotaurine metabolism
    105167783
Enzymes [BR:sind01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105167783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 105167783
NCBI-ProteinID: XP_011085900
LinkDB All DBs
Position
LG8
AA seq 501 aa AA seqDB search
MVLSKTASQSDVSVHSTFASRYVRDSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKALGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCQENAMVLKAGLER
TGRFNIVSKDNGVPLVAFSLKDNSRHNEFEVSETLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDIEKVLHELDLLPARVTEKLIGGAADPVPVEEHHPAVVKKTAIEV
QREITAAWRKFVADRKTNGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaagaccgcttctcagtccgacgtctccgtccactcaaccttcgcctcg
cgatatgttcgcgattcccttcccaggttcaagatgccggagaactcgattccgaaggag
gcagcctaccagatcataaacgacgagctgatgttggacgggaacccgaggctgaatctg
gcgtccttcgtcacgacatggatggagccggagtgtgataagctgataatggcttccgtt
aacaagaactacgtggacatggatgagtaccccgtcaccactgagctacagaaccggtgc
gtgaacatgatcgcgcatcttttcaatgcgccgttgggcgatggggaggcggctgttggt
gtcggcaccgtcggttcgtccgaagccataatgctggccggattggcgttcaagaggaaa
tggcagaacaagatgaaagcgctgggcaaaccctgcgacaagcccaacattgtcacgggc
gccaacgttcaagtgtgctgggagaagttcgcccgttactttgaagtcgagctcaaggaa
gtgaaactgagagacggatactatgttatggacccggagaaggcggtggagatggtggac
gagaacaccatctgtgtggccgcaatcctcggctccaccctcaacggggagtttgaagac
gtcaagcgtctgaacgacctcttgatcgagaagaataaagaaacagggtgggacacacca
atccatgtggatgcagcgagtggtggattcattgcaccatttttgtacccagaattggag
tgggatttcaggttgcctttagtgaaaagtattaatgtgagtgggcacaagtatgggctg
gtgtatgcaggtattgggtgggtgatttggaggagcaaagaggatttacctgaagagctc
atcttccacattaactatcttggggcggatcagcccactttcacactcaacttctctaaa
ggttctagtcaagtaattgctcagtactaccaacttattcgcttgggttatgaggggtac
cgtaacatcatggagaactgccaagaaaacgctatggtcctaaaggccggcctggagcgg
accggccggttcaacattgtgtcgaaagacaacggtgtgcccttggtggccttcagcctc
aaggacaatagccgccacaacgagtttgaagtctcggagacgctccgccgattcgggtgg
atcgtccccgcttacaccatgccgcctgacgcgcagcacgtgaccgttctgcgtgtcgtt
atccgcgaggacttctctcggaccctagcggagaggcttgttttggatatcgagaaagtt
ctgcacgagctcgacttgctcccagctagggttacggagaagctaattggcggcgctgca
gaccccgtacctgtggaggagcaccaccccgccgttgttaagaagaccgccatcgaggtg
cagagggagatcacggcggcttggaggaagttcgttgctgacaggaagactaatggcgtt
tgctaa

DBGET integrated database retrieval system