KEGG   Sesamum indicum (sesame): 105168246Help
Entry
105168246         CDS       T04135                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00010  Glycolysis / Gluconeogenesis
sind00053  Ascorbate and aldarate metabolism
sind00071  Fatty acid degradation
sind00280  Valine, leucine and isoleucine degradation
sind00310  Lysine degradation
sind00330  Arginine and proline metabolism
sind00340  Histidine metabolism
sind00380  Tryptophan metabolism
sind00410  beta-Alanine metabolism
sind00561  Glycerolipid metabolism
sind00620  Pyruvate metabolism
sind00903  Limonene and pinene degradation
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105168246
   00053 Ascorbate and aldarate metabolism
    105168246
   00620 Pyruvate metabolism
    105168246
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105168246
   00561 Glycerolipid metabolism
    105168246
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105168246
   00310 Lysine degradation
    105168246
   00330 Arginine and proline metabolism
    105168246
   00340 Histidine metabolism
    105168246
   00380 Tryptophan metabolism
    105168246
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105168246
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    105168246
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105168246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 105168246
NCBI-ProteinID: XP_011086550
LinkDB All DBs
Position
LG8
AA seq 532 aa AA seqDB search
MAARRISSLVSRTLPLVSRGGKQTYVGRGIYRYSTAAAHEDPIKPPVSVQYDKLLINGQF
VDAASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERQRILL
RFADLVEKHNDDIAALETWDSGKLYEQCAQIEVPMFVRLFRYYAGWADKIHGLTIPADGA
LHVQTLHEPIGVAGQIIPWNFPLVMFAWKVGPALACGNTIVLKTAEQTPLSALLVSKLLH
EAGLPDGVLNVVPGFGPTAGAALCSHMDVDKIAFTGSTETGKVVLELAAKSNLKPVTLEL
GGKSPFIVCEDADIDQAVELAHFSLFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKR
AVGDPFRAGMEQGPQIDSEQFEKILKYIRWGRESGATVEAGGDRFGSKGYYIQPTVFSNV
KDDMRIATDEIFGPVQTILKYKELDEVIRRANNTRYGLAAGVFTHNLDTANTLMRALRAG
TVWINCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPLKNPAWL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgcagaatctcatctcttgtttctcgtactcttcctttggtttctcgtgga
gggaaacaaacttatgttggccgaggaatctatcggtacagcaccgccgcagcccatgag
gatccaatcaagccacctgttagtgtacaatatgataagcttcttatcaatggacaattt
gttgatgcggcatcaggaaaaactttcccaactctggaccctaggactggggaggtaatt
gcacatgttgctgaaggtgatgcagaggatatcaatcgagcggtagctgctgccagaaag
gcttttgacgaagggccatggcctaaaatgactgcttatgagagacagaggatattattg
cgttttgcagatttggttgaaaagcataatgatgatatagcagcacttgagacttgggat
agtggcaagctatatgaacagtgtgctcaaatagaagtaccaatgtttgttagactgttt
cgttattatgctggctgggcagacaagattcatggcctcactattccagctgatggagcc
cttcatgttcaaactttgcatgaaccaattggtgtggctggccagataatcccatggaac
tttcctcttgtgatgtttgcttggaaagtcggtccagcactagcatgtgggaacacgatc
gttctcaaaacagcagagcaaactccattgtctgcattacttgtatcaaagctattacat
gaggctggccttcctgatggtgttttgaatgttgttcctggattcggtccaacagctggt
gctgccctttgtagccatatggatgtggacaagattgccttcactggttcaacagagacc
ggcaaagttgttctcgagttagctgccaaaagcaatctgaagccagttactcttgaactt
ggagggaagtcgccttttattgtctgcgaggatgctgatatcgaccaagctgttgagcta
gcccacttttctctatttttcaaccagggacaatgctgctgtgcgggctcaaggacatat
gtgcatgagaaggtttatgatgaatttgtggaaaaggcaaaagcacgtgccttgaaacgt
gctgttggggacccattcagggcaggcatggagcaaggtcctcagatcgactcagaacag
tttgaaaagatccttaagtatattagatggggtagggaatctggcgctaccgtagaagca
ggaggtgatagatttggttcaaagggctactacattcagccaactgttttctctaatgtg
aaggatgacatgcggattgcaactgatgagatttttggtcccgtgcagactatcctgaaa
tataaggagcttgacgaagtgatccggagggcgaacaacaccagatatggtcttgctgca
ggagtattcactcataatcttgacactgctaataccttgatgagagcattgagagcgggg
actgtatggattaattgcttcgatacatttgatgctacgattccatttggtggctataag
atgagcggaatcgggagggaaaagggagagtacagtctgaagaattacttacaagtgaaa
gcagttgttacccctttgaaaaatccagcttggttgtga

DBGET integrated database retrieval system