KEGG   Sesamum indicum (sesame): 105171443Help
Entry
105171443         CDS       T04135                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sind00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    105171443
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105171443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 105171443
NCBI-ProteinID: XP_011090864
LinkDB All DBs
Position
LG10
AA seq 153 aa AA seqDB search
MVKAVAVLSSSEGVSGKIFFTQEGDGPTTVVGDVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDEVRHAGDLGNIKVGEDGSAHFEIVDKQIPLAGPHSIIGRAVVVHG
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQAA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccgtcgcagtactcagcagcagtgagggtgttagcggcaaaatcttcttc
actcaggaaggagatggtcccacaactgttgttggagacgttagtggccttaagcctgga
ctccatggctttcatgtgcatgcccttggtgacaccaccaatggttgtatgtcaactgga
cctcacttcaatcctgctggcaaagagcatggtgctcctgaggatgaggttcgccatgct
ggtgaccttggtaacatcaaagttggggaagatggatcagcccacttcgaaattgttgac
aagcagataccacttgcaggaccacattccataattggaagagctgtggtcgttcatggc
gatcctgatgatctcggaaagggtggacatgaactgagcaaatccactggaaatgctggt
ggaagagttgcttgcggtatcatcggccttcaagctgcgtag

DBGET integrated database retrieval system