KEGG   Sesamum indicum (sesame): 105173552Help
Entry
105173552         CDS       T04135                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00010  Glycolysis / Gluconeogenesis
sind00051  Fructose and mannose metabolism
sind00052  Galactose metabolism
sind00500  Starch and sucrose metabolism
sind00520  Amino sugar and nucleotide sugar metabolism
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
sind01200  Carbon metabolism
Module
sind_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sind_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sind00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105173552
   00051 Fructose and mannose metabolism
    105173552
   00052 Galactose metabolism
    105173552
   00500 Starch and sucrose metabolism
    105173552
   00520 Amino sugar and nucleotide sugar metabolism
    105173552
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105173552
Enzymes [BR:sind01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105173552
Membrane trafficking [BR:sind04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105173552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 105173552
NCBI-ProteinID: XP_011093636
LinkDB All DBs
Position
LG11
AA seq 496 aa AA seqDB search
MGKVAVAAAVVCTAAVCAAAVVVMRRQMKSSGRWAKAEAILRELEEKCGTPTAKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKDGI
MKQEFEEVSIPPHLMVGSSHELFDFIAAALAKFVDTEGEDFHLLPGRQRELGFTFSFPVR
QLSLASGTLIKWTKGFLIEDAVGQDVVGELTKAMERLGLDMRVAALVNDTVGTLAGGRYN
NPDVIAAVILGTGTNAAYVERAHAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTEYDQI
LDAESLNPGEQIFEKIISGMYLGEIVRRVLCRMAEEASFFGDTIPPKLKIPFILRTPDMS
AMHHDTSPDLKVVGSKLKDILEVPNSSLKMRKIIVEICDIVATRGARLSAAGILGILKKL
GRDTVKEGEKQRSVIALDGGLFEHYTKFRKCMESTLKELLGDVAEDIVVEHSNDGSGIGA
ALLAASHSQYLEIDNS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtggcggtggcggcggcggtggtgtgcactgcagcggtttgtgcggctgcg
gtggtggtgatgaggcggcagatgaagagctcagggaggtgggccaaggcggaggcgatt
ctgagagagttggaggagaagtgtgggacccctacggcgaagctccggcaggtggccgac
gccatgacggtggagatgcacgccggtcttgcctccgaaggtggcagtaagctgaagatg
ctcatcagctacgtggataacctccccactggggatgaaaaaggattattctatgcattg
gaccttggtggaacaaacttccgtgttatgcgggttcagttaggtggtaaagacggtatt
atgaaacaagaatttgaagaagtctcgattcctccacatttgatggttggatcatcacat
gaattatttgactttattgctgctgcccttgcaaaatttgttgatacggaaggtgaagac
tttcatctcttacctggtagacaaagggagcttggtttcaccttttccttcccggttagg
caattatcattagcatcaggaaccctgataaagtggacaaaaggattcctcatagaagat
gcggttggacaagatgttgtgggagagctcacaaaagcaatggaaagactcggccttgat
atgcgtgttgccgctcttgtcaatgatacagttggaacattagctggaggacggtacaat
aatccagatgtcattgctgctgtgatcctgggaacaggaactaatgcagcatatgtcgaa
cgggctcatgcaattccgaagtggcagggtctgctacctaagtccggggaaatggttata
aacatggaatggggtaactttcgatcatcacatcttccacttacggaatatgatcaaata
cttgatgctgaaagtttaaaccctggagaacagatttttgagaagataatttctggtatg
tatctcggagaaatcgtccgtagagttttatgcaggatggccgaagaagcatcctttttt
ggtgataccatcccaccgaaactcaaaattccattcatattgaggactcctgacatgtcc
gctatgcatcacgacacctctcctgatctcaaagtggtcggaagtaaactaaaggatatt
ttggaggtacctaattcctccttgaaaatgaggaaaattatcgtggagatatgcgacatc
gttgccacacgaggggcccgtctctctgctgctgggatacttggtattctcaagaaactc
ggaagagacactgtgaaagagggagagaagcagaggtcagtcatcgctttggacggtgga
ttgtttgagcactatactaagttcagaaaatgtatggagagcactcttaaggagctgctg
ggagatgttgcagaggatatcgtcgtcgagcattcaaatgacggctcgggcattggagct
gctcttctagcagcttctcattcccagtacctggaaatcgacaactcctga

DBGET integrated database retrieval system