KEGG   Sesamum indicum (sesame): 105174195Help
Entry
105174195         CDS       T04135                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00564  Glycerophospholipid metabolism
sind01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105174195
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105174195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox GIDA NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox_3 PIG-Y
Motif
Other DBs
NCBI-GeneID: 105174195
NCBI-ProteinID: XP_011094523
LinkDB All DBs
Position
LG11
AA seq 630 aa AA seqDB search
MAASIRLRRLGAVAAVAGGACFTVLGDPPMASSDRGAPGPTMTALKQKISDPLSAVPSRE
VQESALIGSSPANPLDVLVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCNALPCMTPCFSWFEVIYYWM
GLKMYDLVAGKRLLHLSRYYSAQESVGLFPTLTRKGKDQSLKGTVVYYDGQMNDSRLNVA
LACTAALAGATVLNHAEVISFLRDEGGGRIIGARIRNNLSGKEFDTYAKVVVNAAGPFCD
SLRKMADKEAKPMICPSSGVHVVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTT
DSNTTITMLPEPHEDEIEFILDAISDYLNIKVRRVDVLSAWSGIRPLAMDPKAKNTESIS
RDHVVYEDFPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLSPANKCLTYELQLVGADGWD
PASFTVLAQQYVRMKRSHGGKVVPGVMDTAVAKHLSHAYGTFAERVAAIAQNENLGKRLA
HGYPILEAEVAYCARHEYCESVVDFIARRSRLAFLDTDAAMRAVPRVIEILACEHKWDRS
RQKQEMQKAQEFLETFKSSRNAQFHDGKHN
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttccatacgcctacgccggctcggcgcagtcgccgccgtcgccggaggtgcg
tgcttcaccgtcctcggcgatcctcctatggcctccagtgaccggggcgccccgggtccg
accatgaccgctttaaagcagaaaatttcggaccctttgagcgctgtgccttctcgtgaa
gtccaggagtcggctttgatcgggtccagcccggctaaccccctggacgtcctcgtcgtt
ggcggcggagccaccggctgcggtgtcgcgctggatgccgccacacgcggacttcgtgtc
gggcttgttgagcgagaggatttctcctctgggacttcgtcgaggtctactaaactcatc
catggaggagttcgctatttagagaaagctgtttttaacttagattacgggcagttaaag
ctggttttccatgcccttgaggagcgtaaacaagttattgacaatgctccccatctctgc
aatgctctgccatgtatgacaccatgttttagctggttcgaggtgatttactactggatg
ggtttgaaaatgtatgatctggtggctggcaaacgcttgctccacttgtctagatattat
tcagcgcaggagtcagttggtctctttcccactttaacaagaaagggaaaagatcagagc
ttgaaaggaacagtggtctattatgacggacaaatgaatgattcacgtctgaatgttgca
ttggcatgtactgctgcgctagcaggggctactgtacttaaccatgctgaagtgatatcc
tttcttagggatgagggtggtgggcggataataggtgctaggataagaaataatctatca
ggcaaggagtttgatacatatgcaaaagttgtggtaaatgcggctggtccgttctgtgat
tccctgaggaagatggcagacaaagaagcgaaaccaatgatctgtcccagcagcggtgtc
catgttgtgcttcctgattactattctccggaagggatgggcttgattgttcccaaaact
aaggatggtcgagtcgttttcatgcttccctggttagggagaacagttgctggtaccacc
gactcaaacaccactattacaatgctaccagaacctcatgaggatgagatcgaattcata
ttagatgccatctctgattatcttaatattaaggtacgccgagtagatgttttgtcagct
tggagcggcattcgaccattggcgatggatcctaaagctaaaaacacagagagcatctcc
agagatcatgttgtgtatgaagactttcctggtttagttacaatcactggtggaaagtgg
actacatatagaagtatggcagaggatgcagttgatgcagctataaagtcaggaaagttg
agcccagcaaacaaatgcctgacatatgaactacagctcgtaggtgctgatggatgggat
ccagcatctttcactgtattagctcagcaatacgtgcgcatgaagagatcgcacggtggg
aaggtcgttccaggcgtaatggacactgctgtagcaaagcatttatctcatgcttatggt
actttcgccgaacgtgtagctgccattgcccagaatgaaaatctggggaaaaggctagcc
cacggatacccaatcctggaagcggaagttgcatactgtgctcggcatgagtactgcgaa
tcagtggtggacttcatagccagaaggtctcgccttgcatttctcgacactgacgctgct
atgagggcagtgcctcgtgtcatcgagatattggcttgtgaacacaaatgggatagatcg
aggcaaaagcaggaaatgcaaaaagctcaagaatttctggagaccttcaagtcatcgaga
aatgctcaattccatgatggcaaacacaactaa

DBGET integrated database retrieval system