KEGG   Sesamum indicum (sesame): 105176105Help
Entry
105176105         CDS       T04135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00020  Citrate cycle (TCA cycle)
sind00190  Oxidative phosphorylation
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
sind01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105176105
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105176105
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105176105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 105176105
NCBI-ProteinID: XP_011097110
LinkDB All DBs
Position
LG13
AA seq 627 aa AA seqDB search
MWRCVSRGLRIPSKKSTSAAPISRFFSAQSNGATPSYTVVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA
IQYMVVKAXILEKVRXQFSLEIQFPIFFFLFKLSLICQSLLFIGGQAYRCACAADRTGHA
LLHTLYGQAMKHNTQFFVEYFALDLLVGSDGSCQGVIALNMEDGTLHRFRAASTILATGG
YGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGIL
RNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKE
RLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAVVPGLFA
AGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLEKDAGERTVAWLD
KLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLKDRSLI
WNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEHWMKHTLGYWENEK
VRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtgtcccgtggtctccgcattccctctaagaaatctacctccgccgcc
cccatcagccgtttcttctcagctcaatctaatggggcaacgccatcctatacagtggtg
gatcacacctatgatgcagtggtagttggagcaggaggtgcggggctgagggccgccata
gggttatcagagcatggattcaacacagcttgcattaccaagctttttcccactcgctcc
catactgttgcagcacagggtggaataaatgccgcattggggaatatgacagaggatgat
tggaggtggcacatgtatgacacagtaaagggaagtgattggctaggggaccaggatgcc
atccagtacatggtggtcaaagcttgaattttggaaaaggtacggtgacaattttcactg
gaaatacagttccctatttttttttttttgttcaaactctctttaatctgtcaatcccta
ctcttcataggtggacaagcatatcgttgtgcatgtgctgctgatcgaactggacatgct
ttactgcacacattatatgggcaggctatgaaacataacacacaattttttgtggaatac
tttgcccttgatttacttgtaggcagtgatggtagctgccaaggtgtaattgccttgaat
atggaggatggcaccttacatcggttccgtgctgcctcaacaattcttgctactgggggt
tacggtagagcatacttttctgcaacctctgctcacacttgcactggagatggcaatgct
atggtagcacgtgctgggttgccgctacaggatcttgagtttgttcagttccatccaacg
ggcatatatggtgctgggtgtctcattactgaagggtcccgtggtgaaggtggtattctt
aggaatagtgagggtgaaagattcatggaacgatatgccccaacagctaaggatcttgca
tcaagagatgttgtatcaagatctatgaccatggagattcgagaagggcgtggcgttgga
cccttgaaagatcatatttaccttcacttgaatcatttgcctcctgaggtcctcaaggag
agacttcctggtatctctgaaactgcagccattttcgccggtgttgatgttacaaaggaa
ccaatccctgttttaccaactgtgcattataacatgggtggaattcccacaaatcaccat
ggagaggtggttaccatcaaaggtgatgatcctgatgctgtggttcctggactatttgct
gctggagaagctgcctgtgcatctgttcatggtgccaatcgacttggagccaattcactt
cttgacattgttgtctttggtcgggcttgtgcaaacagggtggcggagatccagaggcca
ggagagaaacaaaagccactagaaaaggatgctggagagaggaccgtcgcatggttggac
aagcttcggaattcaaatggttcccttcccacctctaaaatccggctgaacatgcaacgg
gtaatgcaaaataatgctgctgtatttcggacacaagaaacactggaagaaggctgtcag
ttgattgataaagcctgggagagttttcatgatgtcaagttgaaggacagaagcttgata
tggaattcggacttgatagagactattgagttggaaaaccttttaattaatgcatgcatc
accatgcactctgctgaagccaggaaagaaagtagaggagctcatgcacgtgaagatttt
actaaaagagatgatgaacactggatgaaacatacattaggatactgggaaaatgagaaa
gtacgactggactaccggcctgttcacatgaatacacttgatgatgaagttgaatccttc
cctcccaaggctcgagtatactag

DBGET integrated database retrieval system