KEGG   Sesamum indicum (sesame): 105176938Help
Entry
105176938         CDS       T04135                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00620  Pyruvate metabolism
sind00710  Carbon fixation in photosynthetic organisms
sind01100  Metabolic pathways
sind01200  Carbon metabolism
Module
sind_M00168  CAM (Crassulacean acid metabolism), dark
sind_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
sind_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
sind_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    105176938
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105176938
Enzymes [BR:sind01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     105176938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 105176938
NCBI-ProteinID: XP_011098224
LinkDB All DBs
Position
LG14
AA seq 964 aa AA seqDB search
MASRNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEC
YELSAEYEGKHDPKKLDELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRNK
RKKGDYTDENNATTESDIEETIKRLVVDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERIPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCTDELRSRADELHRSSRRDAKHFIEFWKTIP
PNEPYRVILGDVRDRLYQTRERARNLLSHGMSDISEEATYTNVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITRHLDIGSYRDWSKEQR
QEWLLSELRGKRPLFGPDLPKTEEIADVLDTFHVLAELPSDCFGAYIISMATAPSDVLAV
ELLQRECHVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYKSRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVAKEHGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALLDEIAVVATE
EYRSIVFKEPRFVEYFRLASPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGGAFKYAIGKDIKNLKMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWSFGERLRANYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNVSQA
YTLKRIRDPNYHVKLRPHISKEYMESKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGL
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaggaatttggagaagatggcgtccattgatgcccagttgaggctcctggtt
cctggaaaagtgtctgaggatgacaagcttgttgagtatgatgccttgcttttggatcga
tttcttgatattcttcaggatttgcatggggaggatctcagggaaacggtgcaagaatgt
tacgagctttctgcagagtatgaaggcaaacatgatcctaaaaagttggatgagctcgga
aatgtcttgactagtttggatcccggtgattcaattgttgttgcaaaggctttctcgcac
atgcttaacttggccaacttggctgaggaggtccagattgcttaccgccgtcgaaacaaa
aggaaaaagggagattatactgacgagaacaatgcgactactgaatcggacatagaagag
actatcaagagacttgttgttgatctgaagaagtctcctcaagaagtttttgatgcattg
aagaatcagactgtggatctggtcttaacggctcatcctacacagtctgtaagaagatcc
ttgcttcagaagcatgcaaggatccggaattgcttagcccagttgtatgcgaaagatatt
acacctgatgataaacaggagcttgatgaggctttgcaaagagagattcaagctgctttc
cgaactgatgaaatccgaaggactccccctactccccaagatgaaatgagggcagggatg
agttattttcatgaaacaatctggaaaggcgtaccaaagtttctgcgccgtgttgataca
gcacttaagaatattgggattaacgaacgtattccatataatgcccctctaattcagttt
tcttcttggatgggtggagaccgtgatggcaatccgagggtgactcccgaagtcacaagg
gatgtatgcttattggccaggatgatggcggctaatttgtactactcacaaatagaggat
ctcatgtttgagttgtccatgtggcgttgcaccgacgagcttcgttctcgtgctgatgaa
ctccacagatcttcaaggagagatgcaaagcatttcatagaattttggaaaacaattcca
ccaaacgagccctatcgtgtcattctgggtgatgtgagggataggctctatcagacacgt
gagcgtgctcgtaatttattatctcatggaatgtctgacatctcagaagaggcaacttac
accaatgttgagcagttcttggaacctcttgagctctgttaccgatctctttgtgcttgc
ggggaccggccaatagctgacggtagccttctcgattttctaaggcaagtttccaccttt
gggctgtcacttgtgcggcttgacataaggcaagaatcagacaggcacacagatgttcta
gatgccataacgagacatttggatataggttcatatagggactggtcgaaagagcaacgt
caggaatggctcctatctgagctaaggggtaaacgtcccctctttggacccgatctcccg
aaaactgaagagatcgctgatgttctggacacgttccatgtcttggccgaactcccttct
gactgctttggtgcatacatcatttcaatggcgacagcaccatctgatgtcttagcagtc
gagcttctacaacgtgaatgccatgtgaagcagccattaagagtcgttccgctctttgag
aaactagctgatctcgaggctgcccctgctgctgttgcacgccttttctcgatcgattgg
tacaaaagccggatcaacgggaagcaagaagtcatgatcgggtactccgattctggtaaa
gatgctggtaggctgtcagcagcatggcaattgtacaaagctcaggaggagcttatcaaa
gttgcaaaggaacatggcgtgaaactgacgatgttccacggccgaggcggaactgtcgga
agaggaggtggccccactcacttggctatattgtctcaaccaccagaaactatccatgga
tctctccgtgttacagttcagggagaagttattgaacaatcattcggtgaggagcatttg
tgcttcaggacgctccagcgtttcactgctgctacactagaacacggaatgcatccacct
gtctcccccaaaccagaatggagggcactgctggatgaaattgctgttgttgccaccgag
gagtaccggtcgattgtcttcaaagaaccccggtttgtcgagtatttccgcctagcctcg
ccggaattggaatatggtaggatgaacatcggcagtcgtccttcaaaacgtaaacctagt
ggcgggatcgaatcactaagagccattccttggatcttcgcctggactcagacccgattt
catctccccgtttggctaggctttggaggagcattcaaatatgccataggaaaagatatc
aagaacctgaaaatgctgcaagaaatgtataatgaatggcctttcttcagagtcacgatt
gacttagtcgagatggttttcgccaagggagaccccggcattgctgcattgtatgacaaa
ctcctagtgtcggaagacttgtggtcgtttggcgagcgattgagggccaactatgaggaa
accaagagtcttctgctccagattgccggacacaaggatctcctagaaggcgacccctac
ttgaagcaacggctccgactccgtgactcctacatcacgaccttgaacgtgagccaggcg
tatactctgaagcgaattcgcgaccccaactaccatgtaaagctgaggccccacatttcc
aaggagtacatggaatcgaaaccagctgctgaacttgtgaagttgaaccccacgagtgaa
tacgccccgggactcgaggacaccctcattttgaccatgaagggtattgctgccggcctg
cagaacactggttaa

DBGET integrated database retrieval system