KEGG   Sesamum indicum (sesame): 105177910Help
Entry
105177910         CDS       T04135                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind03030  DNA replication
sind03410  Base excision repair
sind03420  Nucleotide excision repair
sind03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sind00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105177910
   03410 Base excision repair
    105177910
   03420 Nucleotide excision repair
    105177910
   03430 Mismatch repair
    105177910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sind03032]
    105177910
   03400 DNA repair and recombination proteins [BR:sind03400]
    105177910
Enzymes [BR:sind01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105177910
    6.5.1.6  DNA ligase (ATP or NAD+)
     105177910
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105177910
DNA replication proteins [BR:sind03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105177910
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105177910
DNA repair and recombination proteins [BR:sind03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105177910
   NER (nucleotide excision repair)
    Other NER factors
     105177910
   MMR (mismatch excision repair)
    Other MMR factors
     105177910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 105177910
NCBI-ProteinID: XP_011099504
LinkDB All DBs
Position
LG15
AA seq 1409 aa AA seqDB search
MSASKPPKPLNITTAALHLAALSSLSLPPQPQPTFPLVPPPAFIPHSKLIPKTRFIVDGF
KHADPNFSVSYFLSHFHSDHYTGLSPQWSNGIIYCSSITANLLHQILKIPQPFIFPLPLS
QPVIIDGAEVWLVDANHCPGAVQFLFKVPGSCDRGAGSSGVVTFEKYVHTGDFRYCDEMK
NESAVSEFIGADAVFLDTTYCNPKFVFPSQEESIDYIVGVIERIGVENEGVVAKNVLFLV
ATYVIGKERILVEISRRCKRKIHVSARKMAVLSALGFGESGVFTEDELESDVHVVGWNVL
GETWPYFRPNFVKMKEIMSERGYSKVVGFVPTGWTYEVKQNKFSVRSKDSFEIHLVPYSE
HSNYDELREFVKFLKPKRVIPTVGADVEKVDSKQAISMRKHFAGLVNEMAIKQEFLMGFL
RGGSGLVDVEKDCPIVLHNIPDQEDEVIASTPNCCSDVELEGDIKSSFPQQVSASSNLED
MKDNDLEKSVKELQDCLPSWVTLCQMLDLLGAAGGNVVEAVSNFYEHETEFHEQVLPSTS
ASFTSLGNSENQPPLPFESQNVKGINRSEDISFSQNFKLSSSVNIKKSGVSPGKRKRNLD
SKTKKRARADSTGNSSDLKQYRITKFFNKKMPVVPEDSKVEVESCNFNDGQSRLPVDATK
LYKEEVNQFIQIVSGGESLRSYATTILEKTKGDINMALDIYYNDNIGTTIDVNDSNRLME
SECPSRVSSVDDDALVSESSKLETKSDIFPPALPKDNVSVNYISLPPERYSPTEHACWRK
GQPAPYIHIARTFDLVEEEKGKLKATSMLCNMFRSLLVLSPEDVLPTVYLCTNKIAPEHE
NLELNIGGSIVVAALEEACGTSRAKISNLYNSLGDLGDVAQLCRQTQTLLAPPSALTIQG
VFSVLRKISVQTGSGSTTRKKSLIVNLMCSCREKEMKFLVRTLVRNLRIGAMMRTILPAL
AQAIVMNSADEGVAENLKDHIQHLSSAVVESYNILPNLDLLIPSLMEKGIEFSSSTLSMV
PGIPIKPMLAKITNGAPQVLKNFQYMAFTCEFKYDGQRAQIHRLADGSVRVFSRNGDETT
LRFPDLVDIVKDCCLHATDTFILDAEVVAIDRRNSKLMSFQELSSRERGSKDSLIALDKI
KVDICIFVFDIMFANGEQFLDLPLRQRRQYLKDLLGEEKPGYFEYAREMTVESEDADVKN
EATLNRMNSFLNDAIRSSCEGIMVKSLDVNAGYTPSKRSDAWLKVKRDYVEGLSDSLDLV
PIGAWHGNGRKAGWFSPFLMACYNPDTEDFQSVCRVMSGISDAFYTEMKEFFSGDRVLSK
RPPYYKTSEMPDMWFSPEFVWEIRGADFTVSPVHHAAIGLIHPSRGISVRFPRFIRSLSD
RKPEECSTAADIADMFSLQTRKMDVNTKR
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttcaaaaccaccaaaaccgctaaatataaccaccgccgccctccacctcgcc
gccctctcctccctctccctgccgccacagccccaacccacttttccccttgtccctccc
cctgcctttatcccccactcgaaactcattccaaaaacccgcttcatcgtcgacggcttc
aaacacgccgaccccaatttctccgtctcttacttcctctctcacttccactccgaccat
tacacgggtctctctccgcaatggtccaacggcatcatttattgctcttccatcactgct
aatctcctccaccaaatcctcaaaattcctcaacccttcattttccccttacctctctcc
caacccgtgataattgatggcgccgaagtttggctcgtcgacgcgaatcactgccctggg
gcagttcagttcttgttcaaggtcccagggagctgtgataggggtgcaggtagtagtggt
gttgttacatttgagaagtatgtccatactggtgattttaggtattgtgatgaaatgaag
aacgagagtgcagtttctgagtttattggtgctgatgctgtgtttttggatacaacttat
tgtaatcctaagtttgtgtttccgagtcaggaggagtccattgattatattgttggggtg
attgagaggataggggttgagaatgagggtgtagtcgcaaagaatgttctgtttttggtg
gctacatatgtcattggaaaggagcggattttggtggagatatctcggcggtgtaagagg
aagattcatgtgagtgccaggaagatggcggttctgagtgccttgggtttcggggaaagt
ggggtttttacagaggatgagttggagagtgatgttcatgttgttggttggaatgtgttg
ggcgagacttggccatactttcggcctaactttgtgaagatgaaggagattatgagtgag
agaggttattctaaggttgttggttttgttccaactggctggacatatgaagtcaagcag
aataagttttctgtgaggagcaaggattctttcgagattcatcttgttccttatagtgaa
cattcaaactacgatgagctcagagagtttgtgaaatttttgaagccaaaacgtgttatc
ccgacagttggtgctgacgtagagaaagttgatagcaaacaagccatttcaatgaggaag
cattttgctgggttggttaatgaaatggccatcaagcaagaattcttgatgggttttctt
cgtggtgggagcgggctggtggatgtagagaaggattgtcctattgtacttcacaatatt
ccagatcaagaggatgaggtcattgcctctactccaaattgttgcagtgatgttgaattg
gagggtgacataaagtcttcatttcctcaacaggtatctgcttcaagtaatttagaagat
atgaaagataatgacttggagaaatctgtaaaggaacttcaagactgcttgcccagttgg
gtcacgctatgccagatgttggatttacttggtgcagctggtggaaatgttgttgaagct
gtttcaaatttttatgaacatgaaactgagtttcatgaacaggttctccccagtacatct
gcctcctttacttccctgggaaactcagaaaaccagcctcctttaccttttgaatctcaa
aatgtcaagggcataaatcgctctgaagatatctctttcagccaaaatttcaaattatct
agttctgtgaatataaagaagagtggagtttctcctgggaaaaggaagagaaaccttgac
agcaagacaaaaaagagagcaagagcagattcaactgggaattccagtgatttgaagcaa
tatcggataactaagttttttaacaagaaaatgcctgttgtccctgaagatagtaaagtt
gaagttgaatcttgtaactttaatgatggtcaaagtaggttgccagttgatgccacaaaa
ttatacaaagaagaggtgaatcaatttattcaaattgtcagtggtggtgaatcattaaga
agctatgctaccaccattcttgagaagaccaaaggagacattaatatggctctggatata
tattataatgacaatattggtaccaccattgatgttaatgatagtaatagattgatggaa
tctgaatgtcccagcagagtcagctctgtggatgatgacgctctagtatctgagagcagc
aaacttgaaaccaagtctgatatttttcccccagctttaccaaaggataacgtgtctgta
aattatatatcgttgcctcctgaaagatactctcctacagagcatgcttgctggaggaaa
ggacagccagctccatacattcatatagcacgaacttttgatttagtggaagaagaaaag
ggcaagctaaaagctacatcaatgctatgcaacatgtttaggagtttattggtcctatca
ccagaagatgtgctacccactgtgtatttgtgcacaaataaaattgctcctgagcatgaa
aatttggaactaaatattggtggtagcattgttgttgcagctctggaagaagcttgtggg
accagcagagctaaaataagcaatctttataatagccttggtgatcttggtgatgttgct
cagctttgccgccaaacccagacactgcttgctcctccatcagcccttacaattcaagga
gtgttttctgttctccgcaagataagtgtacaaacaggtagtggcagtacaaccaggaag
aaaagcctcattgtgaatctcatgtgttcatgtagagagaaggagatgaaatttcttgtc
agaactttggttaggaacttaaggattggagctatgatgagaaccattcttcctgcttta
gctcaggccattgtgatgaactcggctgatgaaggagtagctgaaaacttgaaggatcat
attcagcatctttcaagtgcagtagttgaatcatataacatacttccaaacttggattta
cttatcccatccttgatggagaaagggattgaattttcatcatcaaccctatcaatggtt
cctggcataccaatcaagcccatgcttgccaagattactaatggagcacctcaggtgctg
aagaatttccaatatatggcgtttacgtgtgaatttaaatatgatggccaacgtgctcaa
attcacagattagcagatggttctgtacgtgtcttctcaaggaatggtgatgaaaccaca
ttgagattccctgatttagttgacatagtcaaggattgttgtcttcatgcaacagatact
tttattttggacgcagaggtggtagcaattgataggaggaacagtaagcttatgtcattt
caagagctttcttcccgggagagagggagtaaggattcgctgattgctttagacaaaata
aaggttgacatatgcatttttgtgtttgacatcatgtttgcaaatggagagcagttcttg
gatctacccctccgtcagcggcgacaatatttgaaggatttacttggtgaagaaaaaccg
ggttacttcgagtatgctagagaaatgacggtggaatccgaagatgctgatgtaaaaaat
gaagctacattgaataggatgaacagttttcttaatgatgccattcgttcctcatgtgaa
ggcatcatggttaaatcgcttgatgttaatgctggatatactccatcaaagcgttctgat
gcctggttgaaggtcaaaagagattatgttgaaggactaagtgattccttggacttggtt
ccaattggagcttggcatggaaatggaagaaaagcaggatggtttagtccttttctgatg
gcctgctacaaccctgatactgaagatttccagagtgtctgtcgtgtaatgtctggaatt
tcagatgctttttacacagagatgaaagagttcttctccggggacagagttctttctaaa
agaccaccatactataagacatccgagatgcctgacatgtggttttctccagagtttgtc
tgggagataaggggcgcggacttcacagtatcaccagttcatcatgctgccattggttta
atccatccatctcgcggtatttcagttagatttcctaggtttatccgatctctatcagat
agaaagccagaagaatgtagcacggctgcagatatagccgacatgttcagtttgcagaca
agaaaaatggatgtaaacaccaaaagatga

DBGET integrated database retrieval system