KEGG   Sesamum indicum (sesame): 105177982Help
Entry
105177982         CDS       T04135                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sind  Sesamum indicum (sesame)
Pathway
sind00020  Citrate cycle (TCA cycle)
sind00190  Oxidative phosphorylation
sind01100  Metabolic pathways
sind01110  Biosynthesis of secondary metabolites
sind01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sind00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105177982
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105177982
Enzymes [BR:sind01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105177982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 105177982
NCBI-ProteinID: XP_011099603
LinkDB All DBs
Position
LG15
AA seq 628 aa AA seqDB search
MWRCVSRGLRIPSKNSTSAFPVRRLFSNQSNAGAPSYTVVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLLMGNDGSCLGVIALNMEDGTLHRFRAASTILATG
GYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGI
LRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLK
ERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKDDDPDAVIPGLF
AAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGDKQKPLGKDAGEKTIAWL
DKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWDSFHDVKLKDRSL
IWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENE
KVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtgtcccgtggcctacgcattccctccaagaattccacctccgctttc
cctgtccgtcgtctcttctctaatcaatcaaatgcgggagcgccgtcatataccgtggtg
gatcacacctatgatgccgtggtcgtaggcgcaggaggtgcggggctgcgtgctgcgata
ggattatcggagcatggttttaatacagcctgcattaccaagctattccctactcgctcc
cacacagttgcggcacagggtgggataaatgctgcactaggaaatatgacagaagatgat
tggaggtggcacatgtatgacacggttaaaggaagtgattggctaggtgaccaggacgcc
attcagtacatgtgccgtgaagcaccaaaagcagttatcgagcttgaaaattatgggtta
ccattttcccggacagaagatgggaagatatatcaacgtgcatttggtggtcaaagcctc
aattttggaaaaggtggacaggcatatcgttgtgcttgtgctgctgaccggactgggcat
gctttgttgcacactctgtatggccaggctatgaaacataacacacaattttttgtggaa
tacttcgcccttgatttactcatgggcaatgatggtagctgcctaggtgtaattgcctta
aacatggaggatggcaccttgcaccggttccgtgctgcctctacaattctggcaactggg
ggttatggtagagcatacttttctgcgacatctgctcacacttgcactggagatggcaat
gctatggttgctcgggcaggactgccactccaggatcttgaatttgttcagtttcatcca
acgggcatatatggtgctgggtgtctcatcactgaagggtcccgaggtgaaggtggtatt
cttaggaatagtgaaggtgaacgattcatggaacgatatgctccaacagctaaagatctt
gcatctagagatgttgtatcaagatctatgaccatggagatccgtgaagggcgtggtgtt
ggacccttgaaggatcatatctaccttcacttgaatcacttgcctcctgaggtccttaag
gaaagacttcctggcatttccgaaacagcagctatttttgctggtgtggatgttacaaag
gagccaatccctgtcctaccaactgtccattataacatgggtggaattcccacaaatcac
catggagaggtggttaccatcaaagatgatgatccagatgctgtgattcctggattattt
gccgctggagaagctgcttgcgcatcagttcatggtgccaatcgactgggagcaaattca
cttcttgatattgttgtttttggtcgggcttgtgctaacagagtcgcggagatccaaaga
ccaggagacaaacaaaagccactcggaaaggatgctggagaaaaaactattgcatggttg
gacaaacttaggaactcaaatggttcccttccaacctccaaaatccggttgaacatgcaa
cgggtaatgcaaaacaatgctgctgtcttccggacacaggaaacacttgaggaaggttgt
cagttgattgataaagcatgggacagttttcatgacgtgaagttgaaggacagaagcttg
atatggaactcagacttgatagaaactattgagttagaaaaccttttgattaatgcatgc
atcaccatgcactctgctgaagcaaggaaagaaagtcgaggagctcatgcacgtgaagat
tttacgaaaagagatgatgagaactggatgaagcatacactaggatactgggaaaatgag
aaagttcggctcgactacaggccagttcacatgaacacacttgatgatgaagttgaatcg
ttccccccaaaggctcgtgtgtattag

DBGET integrated database retrieval system