KEGG   Sesamum indicum (sesame): 105179188Help
Entry
105179188         CDS       T04135                                 

Definition
(RefSeq) uncharacterized protein LOC105179188 isoform X1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
sind  Sesamum indicum (sesame)
Brite
KEGG Orthology (KO) [BR:sind00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sind03036]
    105179188
Chromosome and associated proteins [BR:sind03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    105179188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid
Motif
Other DBs
NCBI-GeneID: 105179188
NCBI-ProteinID: XP_011101080
LinkDB All DBs
Position
Unknown
AA seq 208 aa AA seqDB search
MTERRWSARRMAANARIAMVSLSHLAEKDYVSALIMTMTGKKIVMTGWILFPKLDLIRRL
LMTKNARSFSVIAGPRMQEAFQPGATPAQPGKRHFLCYNMLASITTMEHDGYSHIEIDFH
DTSSGPRVPAMTDYFGFSMASLNESGSVFANPCKGEKNMSTLIYWPFSSWADNSEWSMRL
EGEEVRAIALGSAWVAAITSLNFLQNLH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacagagagacggtggagtgcccgcaggatggctgcgaacgcgaggatagccatggtg
agtttgagccacctagcagaaaaagattacgtaagcgctctaattatgacgatgactggg
aagaagattgtaatgacgggctggattcttttcccaaagctggatctcataagaaggctt
cttatgaccaagaatgcaagaagcttttcagtaattgctgggccaagaatgcaagaagct
tttcagcctggagctactcctgcacagcctggaaagaggcactttctgtgctataatatg
cttgcaagtataaccacaatggaacatgatggatattcacatatagagatagatttccat
gataccagcagtggtccacgtgttcctgcaatgactgactattttggcttctcgatggct
tctctaaatgagagtgggagtgtatttgccaatccatgtaaaggcgagaagaatatgagc
acacttatatattggcccttcagtagctgggcagataatagtgagtggtctatgcgactt
gaaggggaagaagttagagcgatagcacttggaagtgcttgggttgcagccattaccagc
cttaattttcttcaaaatcttcactga

DBGET integrated database retrieval system