KEGG   Sinimarinibacterium sp. NLF-5-8: GT972_00990
Entry
GT972_00990       CDS       T06400                                 

Definition
(GenBank) lytic transglycosylase domain-containing protein
Organism
sini  Sinimarinibacterium sp. NLF-5-8
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: QHS08854
LinkDB
Position
complement(201101..201685)
AA seq 194 aa
MAASVSLCRAGVLCLLCLAVWTAPVLAREIPPPAYQLAAHDAGIPSAVLYAVALQESGIA
LRGQRTPWPWTLNVAGQARRFQTREAACANLRRALREVPATRIDVGLGQINLGYQAHRFD
HPCELLDPYRNLAVAAAILREHHRPGDDWLLAIGRYHRPAGGAPAARYRRSVQKHLARVQ
GSPVPSIASRSHRP
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctgcgtcagtgagcctttgccgggcaggcgtcctgtgcctgctctgcctcgctgtc
tggaccgcgcccgtcctggcgcgggagattccgccgccggcctatcaactggccgcgcac
gacgccggcattccctcggcggtgttgtacgccgtggccttgcaggaaagcggcatcgcg
ctgcgcgggcagcgaactccgtggccctggaccttgaatgtcgccggccaggcacggcgg
ttccagacccgcgaggccgcctgcgcaaacctgcggcgcgcgctgcgggaggtgccggcg
acgcgcatcgacgttggtctggggcagatcaacctcggctaccaggcgcaccgtttcgat
cacccctgcgaactgctggacccgtaccggaatctcgcggtcgccgccgcgatcctgcgc
gaacaccacaggcccggcgatgactggctgctcgccatcggccgctatcaccgccccgcc
ggtggcgcaccggcagcccgctaccgccgcagcgttcaaaaacatctggcgcgtgtgcag
ggcagcccggttccgtccatcgcatcgaggagtcatcgaccatga

DBGET integrated database retrieval system