KEGG   Sinimarinibacterium sp. NLF-5-8: GT972_02880Help
Entry
GT972_02880       CDS       T06400                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sini  Sinimarinibacterium sp. NLF-5-8
Brite
KEGG Orthology (KO) [BR:sini00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT972_02880 (ahpF)
Enzymes [BR:sini01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GT972_02880 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_9 K_oxygenase Thi4 Glutaredoxin NAD_binding_8 HTH_43
Motif
Other DBs
NCBI-ProteinID: QHS09205
LinkDB All DBs
Position
complement(574285..575838)
Genome map
AA seq 517 aa AA seqDB search
MLEAGLKQQLKAYLERVTRPIEITAYYDTSPAAAEMRALLGEIAELCDKISVREGNDARA
RTPSFALSTPGQDIHLTFAGIPLGHEFTSLVLALLQVGGHPSKLAQDVIEQVKNLDADLR
FETYFSLSCQNCPDVVQALNLMAVLNPRITHVAIDGALFEKEVEDRQVMSVPKVYLNGEE
FASGRMGVEEILAKVDTNAGAREAEKIKAKEAFDVLVIGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTLAIENFISVNHTEGPKLATALEQHVREYEVDVMNLQRATQLTPAGDDG
LVSVTLENGAALKAKSVVLATGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKHVAVI
GGGNSGVEAAIDLAGIVSHVTLIEFDHQLRADEVLQRKLRSLPNVTIITSAQTTEVTGDG
ARVNGLTYKDRNTDASHRVDLEGVFVQIGLLPNTEWLKGTVNLTARGEIEIDARGQTNVP
GVFAAGDCTTVPYKQIVIAMGAGATAALSAFDHLIRT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagccggactcaaacaacaactcaaggcctacctggagcgcgtcacgcgcccg
attgaaatcacggcctattacgacacctcccccgccgccgctgaaatgcgcgcgctgctt
ggtgaaatcgctgagctgtgcgacaaaatcagcgtgcgcgaaggcaacgatgcgcgcgcg
cgcaccccctcttttgcgctgagcacgccggggcaagacattcacttaacctttgccggt
attccgctggggcacgagttcacctcgctggtgctggcgctgctgcaagtgggcggccat
ccgtccaagctggcgcaagacgtcattgaacaggttaaaaacctagatgctgatctgcgc
tttgaaacctatttttcgctgtcctgccaaaactgcccggatgtggtgcaggcgctcaac
ctgatggcggtgctcaacccgcgcatcacccacgttgccattgacggcgcgctgtttgaa
aaagaagtggaagaccggcaggtgatgtcggtgcccaaggtttatttaaacggtgaggag
tttgcctccgggcgcatgggcgtggaagaaatcctcgccaaggtcgataccaacgctggt
gcgcgcgaggcggaaaaaatcaaggccaaagaagcgtttgatgtgctcgtcatcggcggc
ggtccggcgggcgctgcggccgcgatctacgccgcgcgcaaaggcattcgcaccggcgtt
gccgctgaacgctttggcggccaggtgctcgacactttggcgattgaaaacttcatttcg
gtcaaccacaccgaaggccccaaactcgccaccgcgctggagcagcatgtgcgcgagtac
gaggtggatgttatgaatctgcagcgcgcgacccagctcacgcccgccggggacgatggc
ctggtgtcggtgacgctggaaaacggcgcggcgctcaaggccaaatcagtagtgctggcc
accggcgcgcgctggcggcagatgaacgtgccgggcgaagatcaataccgcaacaagggc
gtggcttactgcccgcactgcgatggcccgctgttcaagggcaaacatgtggcggtgatc
ggcggcggcaactccggcgtggaagcggcgattgacctcgcgggcatcgtcagccatgtc
acgctgatcgagtttgatcaccagctgcgcgccgatgaggtgctgcaacgcaagctgcgc
agcctgcccaacgtcaccatcatcacctcggcgcaaaccaccgaagtcaccggcgacggc
gcgcgcgtcaatggcctgacctacaaggatcgcaacaccgacgccagccatcgcgtagac
ctggaaggcgtgtttgtacagattggcttgctgcccaataccgagtggctcaagggcacg
gtcaacctcaccgcgcgcggtgagatcgagatcgacgcgcgcgggcaaaccaacgtgccc
ggcgtgtttgcggcgggcgactgcaccaccgtgccgtacaagcaaatcgtcattgccatg
ggtgcgggtgccaccgccgcgctgagtgcgtttgatcatctgattcggacgtaa

DBGET integrated database retrieval system