KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_b52020Help
Entry
SS05631_b52020    CDS       T05069                                 

Definition
(GenBank) Transketolase, C-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00030  Pentose phosphate pathway
sino00710  Carbon fixation in photosynthetic organisms
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
sino01130  Biosynthesis of antibiotics
sino01200  Carbon metabolism
sino01230  Biosynthesis of amino acids
Module
sino_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sino_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SS05631_b52020
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SS05631_b52020
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SS05631_b52020
Enzymes [BR:sino01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SS05631_b52020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ASY59294
UniProt: A0A249P0V0
LinkDB All DBs
Position
pSS05631b:complement(218266..219234)
Genome map
AA seq 322 aa AA seqDB search
MKDVITSPKLHDCRDAFVAVLERLGADNPKLVAVCNDSVGSSKLNGFKSKWPERLVNVGI
AEQNMVGVGAGLANGGLLPFVCGASCFLTGRSLEQIKADIAYSNANVKLIGISSGMAYGE
LGPTHHSIEDFAWTRVLPNLPVIAPCDAIETAAAVEWAVHYQGPVFLRLSRVGVPDLLPA
GHRFELGKANLLRDGDAITLIANGTLTHRILKAAELLAERGIEARVLNMATVRPIDVEAV
VAAARQTGAILTAEEHSTFGGLGSAIAEVVVAEAPVPMKILGVPGIFAPTGSAEFLLDEF
GMSPVAITEAAIALIARKSPRA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtgatcacctctcccaaactgcacgattgccgtgacgccttcgttgcggtg
ctggagcgcctcggcgcggacaaccccaagctcgtggcggtctgcaacgactccgtcggc
tcgtcgaagctcaacgggttcaagtccaaatggccggaacggctggtcaatgtcggcatt
gccgagcagaacatggtgggcgtgggcgccggtcttgccaatggcggtctgctgcccttc
gtctgcggcgcctcctgcttcctgaccggccggtcgctggagcaaatcaaggccgacatc
gcctattccaacgccaatgtgaagctcatcggcatttcctccggcatggcctatggcgag
cttgggcccacgcaccattcgatcgaggacttcgcctggacgcgggtgctgccgaatctg
ccggtcatcgccccctgcgatgcgatcgagaccgccgcggcggtggaatgggcggtccat
taccaggggccggtgttcctgcgcctgtcgcgcgtcggggttccggacctgctgccggcc
ggacacaggttcgagctcggcaaggccaacctgctgcgtgacggcgacgccataacgctg
attgccaacggcacgctgacccaccgcatcttgaaggcggccgagctcctcgccgagcga
gggatcgaggcccgcgtactgaacatggcgacggtccgcccgatcgacgtcgaggccgtg
gtggccgccgcccgccaaaccggggcgatcctgaccgcggaagagcattccaccttcggc
ggcctcggctcggccatcgccgaagtcgtcgtggcagaagctcccgtgccgatgaagatc
cttggcgttccgggcatcttcgccccgaccggctcggccgagttcctgctcgacgaattc
ggcatgtcgcctgtcgccatcactgaggcggccatcgctttgattgcacggaagtctccc
cgcgcttga

DBGET integrated database retrieval system