KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_b57690Help
Entry
SS05631_b57690    CDS       T05069                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00473  D-Alanine metabolism
sino01100  Metabolic pathways
sino01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SS05631_b57690
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SS05631_b57690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sino01011]
    SS05631_b57690
Enzymes [BR:sino01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SS05631_b57690
Peptidoglycan biosynthesis and degradation proteins [BR:sino01011]
 Precursor biosynthesis
  Racemase
   SS05631_b57690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASY59861
UniProt: A0A249P1R6
LinkDB All DBs
Position
pSS05631b:complement(777717..778844)
Genome map
AA seq 375 aa AA seqDB search
MNRHALHVPDRQTVGGASGYLTIDLAALRRNYRKLSTRVAPATAAAVVKADAYGLGAEQV
SDALHAEGCRHFFVAHLPEAVKLGPLLPNDTQIFVLNGLQPGTEITCAKARIVPVLNSLE
QFRRWSLTARKLGRVLPAVLQFDTGMSRLGVPPEERTPLAADLEGCGNIEILFIMSHLAC
ADELDNGQNAEQLAEIGRIAAEFPGLSVCLANSGGIFMGDDYHGVLSRPGIALYGGAPTA
GKPNPMEPVVRLDVAVIQTRTVPAGTRVGYGGAHVTSAETRLATIAAGYADGLPRSLSHR
GAVFYDGVRLPFVGRVSMDSITVDISALPEGTLTLGSLVEVLGPHQTLEELAEAGGTISY
EILTSLGRRYERRYR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcatgccttgcatgttccagatcgacaaacggtgggtggcgcttcgggctac
ctgacgatcgatcttgccgccttgcggcggaattatcgaaagctttcgacaagggtcgca
ccggcaaccgccgccgcggtggtcaaggccgacgcctatggccttggcgccgagcaggtc
tccgacgccctgcatgcggaaggctgccggcatttctttgttgcgcatctccccgaggcg
gtgaagctcggaccgcttttgccgaacgacacgcagatattcgtgctcaacgggctgcag
cccggaacggagatcacctgcgccaaggcccgcatcgttccggttctcaactctctcgag
caattccgccgctggtcgctgacggcgcggaagctcgggcgcgttcttcccgccgtcttg
cagttcgacacgggcatgtcgcgcttgggggttcccccggaggaacgaaccccgcttgcg
gctgatctcgagggctgcggcaatatcgaaattctgttcatcatgagccacctcgcctgc
gccgacgagctggacaatggccagaatgcagagcagctcgccgagatcggtcggatcgcc
gccgagtttccaggcttgagcgtctgcctagccaattccggcggcatattcatgggcgac
gactatcacggtgtgctgtctcgtcccggcatcgccctctacgggggagcacccacagcg
ggcaagcccaatccaatggagccggtcgtgcggctcgacgttgccgtcattcagacgaga
acggtgccggccggcacgcgggtcggatatggcggtgcgcatgtgacttccgccgaaacc
aggcttgccacgatcgccgcaggctatgccgacggcctgccgcgcagtctcagccatcgc
ggcgccgttttctacgacggcgttcgcctgccgttcgtcgggcgcgtctcgatggacagc
ataaccgtcgatatttccgcccttcccgaaggcacgcttacgctgggaagccttgtcgag
gttctcggccctcaccaaacgcttgaagaactggcggaagcaggcggcaccatctcctat
gaaattctgactagcctcggccgccgctacgagcgtcgctaccgctga

DBGET integrated database retrieval system