KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_b58300Help
Entry
SS05631_b58300    CDS       T05069                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00250  Alanine, aspartate and glutamate metabolism
sino00410  beta-Alanine metabolism
sino00640  Propanoate metabolism
sino00650  Butanoate metabolism
sino01100  Metabolic pathways
sino01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SS05631_b58300
   00650 Butanoate metabolism
    SS05631_b58300
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SS05631_b58300
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SS05631_b58300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sino01007]
    SS05631_b58300
Enzymes [BR:sino01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SS05631_b58300
Amino acid related enzymes [BR:sino01007]
 Aminotransferase (transaminase)
  Class III
   SS05631_b58300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASY59922
UniProt: A0A249P2I0
LinkDB All DBs
Position
pSS05631b:862819..864087
Genome map
AA seq 422 aa AA seqDB search
MTSLTERKNAAISRGVGMTTQIYAERAENAEIWDKEGNRFIDFASGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNALTPGTFAKKTIFVTTGAEAVENAVKIAR
AATGRQAIIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVSVEQS
IAALKKLFAADVDPGRVAAIILEPVQGEGGFYPAPTAFLKALREICDQHGILLIADEVQT
GFARTGKLFAMQHHDVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPI
GIAAAHAVLDVIEEEQLCERANQLGNRLKQRLAEIREKAPEIADIRGPGFMNAVEFNDAK
PNLPSAEFANKARLVALEKGLILLTCGVHGNVIRFLAPITIQEEVFAEALDILEASIVEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaacgcaagaatgccgccatttcccgcggcgtggggatgacaacg
cagatctatgccgagcgcgccgaaaatgccgagatctgggacaaggaaggcaatcgcttt
atcgatttcgcttccggcatcgccgtggtcaataccggacaccgccatccgaaggtgatc
gctgccgtcaaggcgcagctcgatcgcttcacccacacctgccatcaggtcgttccctat
gagaactacgttcacttggcagagcggctgaatgcgctcacccccggcacgttcgccaaa
aagacgatcttcgtcaccaccggcgccgaggcggtcgaaaacgcggtgaagatcgcccgc
gccgcaaccggacgccaggccatcatcgccttcggcggcggcttccatggccgcaccttc
atgggcatggcgctgaccggcaaggtcgtgccctacaaggtcggcttcggcgcgatgcca
gccgacgtgttccatgcccccttcccgatcgagttgcacggcgtcagcgtcgagcagtcg
atcgcagcgctgaagaagctctttgccgccgacgtcgatccgggccgcgtcgcggctatc
atcctcgaaccggttcagggcgaaggcggcttctatccggccccgaccgcgttcctgaag
gcactccgcgagatttgcgatcagcacggcatcctgttgatcgccgacgaagtccagacc
ggctttgcccgcaccggcaagctcttcgctatgcagcatcatgacgttgctccggatctg
acgacgatggcgaagagcctcgccggcggctttccgctcgcggcggtgacgggccgcgcc
gagatcatggacgcgccgggcccggggggccttggcggcacctatggcggcaatccgatc
ggcatcgcagccgcccacgccgtgctcgacgtcatcgaggaagagcagctttgcgagcgg
gcaaaccagctcggcaaccggctcaagcagcgccttgccgagatccgcgaaaaggcgccg
gagatcgccgacatccgcggccccggcttcatgaacgccgtcgaattcaatgacgcgaaa
ccgaacctgccgagcgcggagttcgccaacaaggcccgcctcgtcgccctcgaaaaggga
ttgatcctgctcacctgcggcgtccacggcaatgtcatccgcttcctggcgccgatcacc
atccaggaagaagtcttcgccgaagcgctcgatatcctcgaagcatcgatcgtcgaagcg
cgcggttga

DBGET integrated database retrieval system