KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_b62900Help
Entry
SS05631_b62900    CDS       T05069                                 

Definition
(GenBank) Adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00230  Purine metabolism
sino01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SS05631_b62900
Enzymes [BR:sino01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     SS05631_b62900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc dCache_1
Motif
Other DBs
NCBI-ProteinID: ASY60382
UniProt: A0A249P3U0
LinkDB All DBs
Position
pSS05631b:complement(1337413..1339335)
Genome map
AA seq 640 aa AA seqDB search
MYRPKLAQVVVLLLLLAVLSTAALIHLIWQRAASENIDEVVASLDTQTAGSVRNDLTSTL
ALVSSTAEIVRSIFFQGAISAGDEVKREFLFLSLLREQSAITWIGFGFPDGRFFGSHATA
DGRIEMVEIGVAEPGELRQLRRDRYRPIPGDIFFEQRIKAESAYVALGAPWYRLGRDGGD
PVWTVTNVLPNGFEPSIVLSTRVDMFGKFAGVVMVAVSLRRLSQALKAVNMPVGSKAFVL
DEHGRVLANSQPSDGVMAAHFSDFPESDAVTAAAAEAVALNGGAAFRAVTQSAALGPVFV
SSSRLPFERWRLITATPRSTFASGIDENIRRIPIAVLAIAGLAATTAVVFANLLFARPLA
RLAVQLRAVEHFSLESVRHHPTFLAELNDFSDALKRMSIGLSAFARYMPLDVVRPLVEGS
IEPKPGGELCDITVMFADLPGFTELTERLGPAVEPHLTRFLTTAVAAIHAEGGTVDKFIG
DAVMAIWNAPGRQADHAARACRAATAIRDAMHTEPPVSVGHGEVRVRIGINSGTALIGNI
GSAERLSYTAIGDTVNLASRLVGVAKEHGVEIVLSDATVQASDAFAHTTSLGLATVRGKA
EPVAVYTIDPPDVAFQGGDNGNGTYHGDDDCLLTAQAFRC
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcccgaagctcgcccaagtcgtcgtgcttctgctcttgctcgcggtcctgtcg
actgccgcgctcatccatcttatctggcagcgtgccgccagcgagaacatcgacgaggtc
gtagccagtctcgatacgcagacggccgggtccgtccgcaatgatctcacctcgacgctc
gccctcgtttcgagcacggctgagatcgtccgatccatctttttccagggtgccatcagc
gccggcgacgaggtgaaacgcgagttcctgttcctttccctgttacgcgaacagtcggcg
atcacctggatcggcttcggctttccggatgggcgcttcttcggttcgcatgcgactgcc
gacgggcggatcgaaatggtcgaaatcggcgtcgccgagccgggagaattgcgtcaactc
aggcgtgaccgctatcggccgatccccggagacatctttttcgagcagcgcatcaaggcg
gaaagcgcctatgtggcgctcggcgcgccctggtatcgtctgggaagggacggaggtgac
cctgtctggacggtcaccaatgttctgccgaacgggttcgagccatccatcgtcctctcg
acgcgcgtcgacatgttcgggaagtttgccggcgtggtgatggtggcggttagtctcaga
cgcctgtcgcaagcgctcaaggcggtcaacatgccagtcggcagcaaggccttcgttctc
gatgagcatggccgcgtactggccaactcgcagccttccgacggtgtgatggcggcgcac
ttttccgatttcccggagtctgatgccgtcacggcggccgcggcagaggcggtggctctc
aacggaggagctgcgtttcgtgccgtcacgcaaagcgccgcactcggacccgtctttgtg
tcgtcgtcgcgccttccgtttgagcgatggcggctcatcaccgccacgcctcggtcgacc
ttcgcaagcggcatcgacgagaatatccggcgcattccgatcgcagtcttggcaattgcg
ggtctcgcggcaaccacggccgtcgtcttcgccaatttgctctttgctcggccgctcgcg
cggctggcggtacagttgcgtgcggtcgagcacttctcgcttgagagcgtccggcatcac
ccgacctttctggccgagctcaacgacttctccgacgccttgaagcgtatgtcgatcggg
ctttcggcttttgctcgctacatgccgctcgacgtcgtgcggccgctcgtcgaaggtagc
atcgagccgaagccgggcggtgagctttgcgacattacggtgatgttcgccgacctgccc
gggttcacggaactgaccgagaggctcggaccggccgtcgagccgcacctgacgcgcttc
ctgacgaccgcggtcgccgccatccatgcggagggcggtacggtcgacaagttcatcggc
gatgccgttatggccatctggaatgcacccggaaggcaggcggatcacgccgctcgggcc
tgccgcgccgcaacggcaatccgggatgcgatgcacacagagccgcccgtctcagtcggg
catggcgaggtccgcgtgcgcatcggcatcaacagcgggacggcgctgatcggcaatatc
ggctcggctgagcggctgagctacaccgccatcggcgacacggtcaatctggcgagcagg
ctcgtgggcgttgccaaggagcatggcgtcgagatcgtcctcagcgatgcgacggtgcag
gcgtccgatgcatttgcgcacacgacgtctctcggcctagctacggtccgcggcaaggcc
gaaccagtggccgtgtacacgatagacccgccggatgtcgcgtttcagggaggagacaat
ggaaatggcacttatcacggcgatgatgattgcttacttacagctcaagcatttcgttgc
tga

DBGET integrated database retrieval system