KEGG   Sinorhizobium sp. CCBAU 05631: SS05631_c01580Help
Entry
SS05631_c01580    CDS       T05069                                 

Definition
(GenBank) Enoyl-CoA hydratase [isoleucine degradation]
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sino  Sinorhizobium sp. CCBAU 05631
Pathway
sino00071  Fatty acid degradation
sino00280  Valine, leucine and isoleucine degradation
sino00281  Geraniol degradation
sino00310  Lysine degradation
sino00362  Benzoate degradation
sino00380  Tryptophan metabolism
sino00410  beta-Alanine metabolism
sino00640  Propanoate metabolism
sino00650  Butanoate metabolism
sino00903  Limonene and pinene degradation
sino00930  Caprolactam degradation
sino01100  Metabolic pathways
sino01110  Biosynthesis of secondary metabolites
sino01120  Microbial metabolism in diverse environments
sino01130  Biosynthesis of antibiotics
sino01200  Carbon metabolism
sino01212  Fatty acid metabolism
Module
sino_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sino00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SS05631_c01580
   00650 Butanoate metabolism
    SS05631_c01580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SS05631_c01580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SS05631_c01580
   00310 Lysine degradation
    SS05631_c01580
   00380 Tryptophan metabolism
    SS05631_c01580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SS05631_c01580
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SS05631_c01580
   00281 Geraniol degradation
    SS05631_c01580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SS05631_c01580
   00930 Caprolactam degradation
    SS05631_c01580
Enzymes [BR:sino01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SS05631_c01580
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SS05631_c01580
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SS05631_c01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 FAD_binding_3 UDPG_MGDP_dh_N NAD_binding_8 2-Hacid_dh_C NAD_binding_7 F420_oxidored ApbA Pyr_redox_2 Sacchrp_dh_NADP Shikimate_DH NAD_Gly3P_dh_N Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ASY55117
UniProt: A0A249NNU9
LinkDB All DBs
Position
complement(152356..154569)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPEKSMNVFTQEVMEELDAIVDQTTADTAVKGVVITSGK
SSFSGGADLSMIKSMFTLQAEEKKNDPANAAQKLFNLVGRMTRLFRKLETSGKPWVSAIN
GTCMGGAFELSLACHGRVASNSKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTAARAKAMGLVHEVVEPEKLIEAAKAMIKNGLKAVQPWDEKGFKLPGGGVWTPAS
AQLWPAASAILRRETYGNYPGAIAILKCVYEGLQVPFDTGLKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKSEFKKVGVVGAGFMGASIAYVTAAAGITVTLIDRDME
AAEKGKAHSEGLVRDSVGKGRLTKEEGEALLARITPSADYGDLKDAGLVVEAVFEDRQVK
KDVIEKVEAVIAPDAIFASNTSTLPITGLAKNSKRPEQFIGVHFFSPVEKMMLTEVILGK
ETGDRALATALDYVAAIKKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIDGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKAVDPRHMALVNKLVDELDRRGRKNG
KGFYEYPAKPAKKYLWPGLKDLYPQKAADKVDVEVLKQRFLATIALEAARTMEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGAKAFVALCDKLAKEYGEHFKPTPLLKEMAEKG
ETFYGRFDPYGAAKRAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgcagacggcatcgcactcgtcacctgg
gacatgccggagaagtcgatgaacgtcttcacccaggaggtgatggaggagctcgacgcg
atcgtcgaccagacgaccgccgacaccgccgtcaagggtgtggtcatcacctccgggaaa
tcgtccttctccggcggcgccgacctctcgatgatcaagtcgatgttcacgctgcaggcc
gaggagaagaagaacgatccggccaatgccgcgcagaagctcttcaatctcgtcggccgc
atgacccggctcttccgcaagctcgaaacctcgggcaagccttgggtctcggcgatcaac
ggcacctgcatgggcggcgccttcgagctgtcgctcgcctgccacggccgcgtcgcttcc
aattcgaaatccgtgaagatcgccctccccgaggtcaaggtcggcatctttccgggcgcc
ggcggcacgcagcgcgtgccgcggctcaccaacacgcaggacgcgctgcagatgatgacc
accggttcgtcgctgaccgctgcacgcgccaaggcgatgggtctcgtgcacgaggtggtc
gagccggagaagctgatcgaggccgccaaggcgatgatcaagaacggtttgaaggccgtg
cagccctgggacgagaaaggcttcaagcttccgggcggcggcgtctggacgcccgcctcg
gcccaactctggccggcggcttccgccattcttcgtcgcgagacctacggcaactatccg
ggcgcgatcgccatcttgaaatgcgtctacgaagggctgcaagtgccgttcgataccggc
ctcaagatcgagcagcgctatttcaccgaaatcctgcagaccaccgaggcgttctcgatg
atccgctcgctgttcgtttcgatgcaggaactcggcaagggcgcgcgtcgcccggccggc
gtgccgaagtccgaattcaagaaggtcggcgtcgtcggggccggcttcatgggtgcctcg
atcgcctatgtgacggctgccgccggcattacggtcaccctcatcgaccgcgacatggaa
gcggccgagaagggcaaggcgcattcggaaggcctggttagggattccgtcggcaagggc
cggctgacgaaggaagagggcgaagcactgctcgcccggatcacgccgtctgccgattat
ggcgacctcaaggatgccggtctcgtcgtcgaggcggtgttcgaggaccggcaggtcaag
aaggacgtgatcgaaaaggtcgaggccgtcatcgcacccgacgcgatcttcgcctcgaac
acctcgacgctgccaatcaccgggcttgccaagaactcgaagcggccggagcagttcatc
ggcgtccatttcttctcgccggtcgagaagatgatgctgaccgaagtgatcctcggcaag
gagaccggcgaccgtgcgcttgccacggcactcgactatgtcgcggcgatcaagaagacg
ccgatcgtcgtcaacgacacccgcggcttctacgtcaatcgctgcgtcttccgctatatc
cacgaagcctatgatatgctgatcgatggcgtgcccccggcgatgatcgagaacgccgca
aagatggccggcatgccggtcgggccgttgtcgctcaacgacgaggtggcaatcgatctc
agccagaagatcctcaaggccaccgtcgccgatctcggcgaaaaggctgtcgacccgagg
cacatggcgctggtcaacaagctggtcgacgaactcgaccggcgcggccgcaagaacggc
aagggcttctacgagtatccggcaaagccggccaagaagtatctctggccgggcctcaag
gacctctacccacaaaaggccgccgacaaggtcgatgtcgaggtgttgaagcagcgcttc
ctggcaacgatcgcactggaagcggcccggacgatggaggaaggcatcgtcaccgatccg
cgcgaggcggatgtcggctcgatcctcggcttcggcttcgcaccctataccggcggcacg
ctctcctatatcgacggcatgggcgccaaggcctttgtcgcgctctgcgataaacttgcc
aaggagtatggcgagcacttcaagccgacgccgctcttgaaggaaatggccgaaaagggc
gagaccttctacggacggttcgacccctacggtgcggcgaagagggcggcttaa

DBGET integrated database retrieval system